UniProtKB-O00754

Protein Lysosomal alpha-mannosidase
Gene MAN2B1
Status Reviewed
Source 22Rv1 cell xenograft (prostate cancer); ARO Cell Line (Thyroid Cance); Breast Cancer cell lines; Breast cancer cell lines; Breast cancer xenografts; Breast cancer xenograftsPBMC Macrophage cells; Breast cell lines; Breast tumor; Colorectal cancer cell line, HCT-116 (colorectal cancer); Colorectal tumor; DLBCL cell lines (Diffuse large B-cell lymphoma); DRO-1 Cell Line (Thyroid Cance); HCC cell lines (Liver); HCC cell lines (Liver)Jurkat T cell line; HCCLM3 cell line (Liver); HEK293 cell line (embryonic kidney); HEK293T cell line (embryonic kidney); HEK293T cell line (embryonic kidney)Jurkat T cell line; Hela cell line (cervical cancer); HuH-7 cell line (Liver); IGROV-1/CP cell line (Ovarian cancer)IGROV-1/CP; Jurkat T cell line; K562A cell line (Leukemia); LNCap/PC3 cell lines (Prostate cancer); Liver; Liver tumor (HCC); LnCap cell line (Prostate cancer); Non-small Cell Lung Carcinoma; OVCAR-3 cell line (Ovarian cancer); Ovarian cancer cell lines; Ovarian tumor; Pancreatic islets; Pancreatic isletsJurkat T cell line; Platelet; Prostate; Prostate cancer metastasis to liver; Prostate tumor; SKOV-3 cell line (Ovarian cancer); Saliva; Serum; Spermatozoa; TPC-1 Cell Line (Thyroid Cance); Urine; XTC-1 Cell Line (Thyroid Cance); ovarian tumor
Years 2003-2015

Glycosites

Site Identified Peptides Year(Publication ID)
133 nATQEVVR 2015(1);
133 WWHQQTnAT 2014(33);
133 WWHQQTnATQE 2014(33);
133 HQQTnATQEVVR 2014(33);
133 WHQQTnATQEVVR 2014(33);
133 WWHQQTnATQEVV 2013(37);
133 HQQTnATQEVVRDL 2014(33);
133 WWHQQTnATQEVVR 2007(62); 2009(62); 2009(62); 2009(52); 2012(40); 2013(16); 2014(25); 2014(33); 2014(1); 2015(2); 2015(unpublished);2015(unpublished);2015;2015;2015;2007;2007;
133 WHQQTnATQEVVRDL 2014(33);
310 RTnHTVMTMGSDF 2014(33);
310 YRTnHTVMTMGSDF 2014(33);
310 TnHTVMTMGSDFQYE 2014(33);
310 TnHTVMTMGSDFQYENANMWFK 2014(13); 2014(16); 2014(33); 2015(unpublished);2015(2);
367 AnITWSVK 2014(16);
367 AnLTWSVK 2007(62); 2009(62); 2009(63); 2009(57); 2011(48); 2012(13); 2014(19); 2014(22); 2014(33); 2014(1); 2015(2); 2015(12); 2015(unpublished);2015(unpublished);2015(unpublished);2015;2015;2015;2007;2007;2007;
367 ELNKAnLTW 2014(33);
367 LWELNKAnL 2014(33);
367 LNKAnLTWSVK 2014(33);
367 LWELNKAnLTW 2014(33);
367 WEINKAnITWSVK 2013(37);
367 NKAnLTWSVKHDDF 2009(64);
497 nISICPLSQTAAR 2015(1);
497 CQQLnISICPLSQTAAR 2014(33);
645 FWYnASIGDNE 2014(33);
645 WYnASIGDNESDQASGAY 2014(33);
645 FWYnASIGDNESDQASGAY 2014(33);
645 QTFFWYnASIGDNESDQASGAYIFRPNQQKPIPVSR 2014(16);
645 QTFFWYnASIGDNESDQASGAYIFRPNQQKPLPVSR 2015(unpublished);2015(2);
651 FWYNASIGDnE 2014(33);
651 WYNASIGDnESDQASGAY 2014(33);
651 FWYNASIGDnESDQASGAY 2014(33);
651 QTFFWYNASIGDnESDQASGAYIFRPNQQKPIPVSR 2014(16);
651 QTFFWYNASIGDnESDQASGAYIFRPNQQKPLPVSR 2015(unpublished);2015(2);
692 VHQnF 2014(33);
692 VHQnFSAW 2014(33);
692 VQEVHQnF 2014(33);
692 nFSAWCSQVVR 2015(1);
692 TPLVQEVHQnF 2014(33);
692 VQEVHQnFSAW 2014(33);
692 VKTPLVQEVHQnF 2014(33);
692 VQEVHQnFSAWCS 2013(37);
692 TPLVQEVHQnFSAW 2014(33);
692 VHQnFSAWCSQVVR 2014(33);
692 TPIVQEVHQnFSAWCSQVVR 2013(43); 2014(16);
692 TPLVQEVHQnFSAWCSQVVR 2009(62); 2009(62); 2009(62); 2009(62); 2011(58); 2012(52); 2013(40); 2014(18); 2014(33); 2015(1); 2015(2); 2015(unpublished);2015(unpublished);2007(unpublished);2007(Unpublished ); 2007;2007 ;
766 KLnQTEPVAGN 2014(33);
766 LnQTEPVAGNY 2014(33);
766 KLnQTEPVAGNY 2014(33);
766 RPTWKInQTEPVA 2013(37);
766 LnQTEPVAGNYYPV 2014(33);
766 InQTEPVAGNYYPVNTR 2014(16); 2014(32); 2014(32);
766 LnQTEPVAGNYYPVNTR 2007(75); 2007(62); 2009(62); 2009(62); 2009(64); 2009(54); 2011(56); 2011(57); 2011(48); 2012(50); 2012(52); 2012(34); 2013(34); 2013(34); 2013(38); 2013(40); 2013(13); 2014(14); 2014(15); 2014(17); 2014(18); 2014(22); 2014(25); 2014(33); 2014(1); 2015(2); 2015(12); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015;2007;2007;2007;2007;2007;2007;2007;
766 KLnQTEPVAGNYYPVNTR 2014(33);
766 KLnQTEPVAGNYYPVNTRIY 2014(33);
766 DYRPTWKLnQTEPVAGNYYPVNTR 2009(62); 2012(52); 2014(33); 2015(2);
832 nGSGAWVR 2014(33); 2015(1);
832 GVSEPIMEnGSGAWVR 2014(16);
832 GVSEPLMEnGSGAWVR 2007(75); 2011(57); 2014(13); 2014(33); 2015(2); 2015(unpublished);2007;
832 KDDGRGVSEPLMEnGSGAW 2014(33);
930 nLSAPVTLNLR 2014(14); 2014(22); 2014(33); 2015(1); 2015(1); 2015(2); 2015(12); 2015(unpublished);2015;2015;2015;2015;2015;2007;
930 AVGEDSGRnLSAPVTL 2014(33);
930 AVGEDSGRnLSAPVTLNLRDLF 2014(33);
930 RLEHQFAVGEDSGRnLSAPVTL 2014(33);
930 IEHQFAVGEDSGRnISAPVTINIR 2014(16);
930 LEHQFAVGEDSGRnLSAPVTLNLR 2003(83); 2007(75); 2012(52); 2013(34); 2014(14); 2015(1); 2015(unpublished);2015(2); 2015(unpublished);2015(unpublished);2015(unpublished);
989 nITLEPMEIR 2015(1);
989 DPAnITLEPMEIR 2011(54); 2012(48); 2014(14); 2014(33); 2007(unpublished);2007(unpublished);
989 DPAnITLEPMEIRTF 2014(33);

Sequence

1112131415161718191
MGAYARASGVCARGCLDSAGPWTMSRALRPPLPPLCFFLLLLAAAGARAGGYETCPTVQPNMLNVHLLPHTHDDVGWLKTVDQYFYGIKNDIQHAGVQYI
101111121131141151161171181191
LDSVISALLADPTRRFIYVEIAFFSRWWHQQTNATQEVVRDLVRQGRLEFANGGWVMNDEAATHYGAIVDQMTLGLRFLEDTFGNDGRPRVAWHIDPFGH
201211221231241251261271281291
SREQASLFAQMGFDGFFFGRLDYQDKWVRMQKLEMEQVWRASTSLKPPTADLFTGVLPNGYNPPRNLCWDVLCVDQPLVEDPRSPEYNAKELVDYFLNVA
301311321331341351361371381391
TAQGRYYRTNHTVMTMGSDFQYENANMWFKNLDKLIRLVNAQQAKGSSVHVLYSTPACYLWELNKANLTWSVKHDDFFPYADGPHQFWTGYFSSRPALKR
401411421431441451461471481491
YERLSYNFLQVCNQLEALVGLAANVGPYGSGDSAPLNEAMAVLQHHDAVSGTSRQHVANDYARQLAAGWGPCEVLLSNALARLRGFKDHFTFCQQLNISI
501511521531541551561571581591
CPLSQTAARFQVIVYNPLGRKVNWMVRLPVSEGVFVVKDPNGRTVPSDVVIFPSSDSQAHPPELLFSASLPALGFSTYSVAQVPRWKPQARAPQPIPRRS
601611621631641651661671681691
WSPALTIENEHIRATFDPDTGLLMEIMNMNQQLLLPVRQTFFWYNASIGDNESDQASGAYIFRPNQQKPLPVSRWAQIHLVKTPLVQEVHQNFSAWCSQV
701711721731741751761771781791
VRLYPGQRHLELEWSVGPIPVGDTWGKEVISRFDTPLETKGRFYTDSNGREILERRRDYRPTWKLNQTEPVAGNYYPVNTRIYITDGNMQLTVLTDRSQG
801811821831841851861871881891
GSSLRDGSLELMVHRRLLKDDGRGVSEPLMENGSGAWVRGRHLVLLDTAQAAAAGHRLLAEQEVLAPQVVLAPGGGAAYNLGAPPRTQFSGLRRDLPPSV
901911921931941951961971981991
HLLTLASWGPEMVLLRLEHQFAVGEDSGRNLSAPVTLNLRDLFSTFTITRLQETTLVANQLREAASRLKWTTNTGPTPHQTPYQLDPANITLEPMEIRTF
10011011
LASVQWKEVDG

Reference

ID Publication
1Sun S, Shah P, Eshghi ST, Yang W, Trikannad N, Yang S, Chen L, Aiyetan P, Hoti N, Zhang Z, et al: Comprehensive analysis of protein glycosylation by solid-phase extraction of N-linked glycans and glycosite-containing peptides. Nat Biotech 2015, advance online publication.
2Shah P, Wang X, Yang W, Eshghi ST, Sun S, Hoti N, Chen L, Yang S, Pasay J, Rubin A: Integrated Proteomic and Glycoproteomic Analyses of Prostate Cancer Cells Reveal Glycoprotein Alteration in Protein Abundance and Glycosylation. Molecular & Cellular Proteomics 2015, 14:2753-2763.
12Weng Y, Sui Z, Jiang H, Shan Y, Chen L, Zhang S, Zhang L, Zhang Y: Releasing N-glycan from Peptide N-terminus by N-terminal Succinylation Assisted Enzymatic Deglycosylation. Scientific Reports 2015, 5.
13Yang W, Laeyendecker O, Wendel SK, Zhang B, Sun S, Zhou J-Y, Ao M, Moore RD, Jackson JB, Zhang H: Glycoproteomic Study Reveals Altered Plasma Proteins Associated with HIV Elite Suppressors. Theranostics 2014, 4:1153.
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
15Chen R, Seebun D, Ye M, Zou H, Figeys D: Site-specific characterization of cell membrane N-glycosylation with integrated hydrophilic interaction chromatography solid phase extraction and LC-MS/MS. Journal of Proteomics 2014, 103:194-203.
16Deeb SJ, Cox J, Schmidt-Supprian M, Mann M: N-linked Glycosylation Enrichment for In-depth Cell Surface Proteomics of Diffuse Large B-cell Lymphoma Subtypes. Molecular & Cellular Proteomics 2014, 13:240-251.
17Fang C, Xiong Z, Qin H, Huang G, Liu J, Ye M, Feng S, Zou H: One-pot synthesis of magnetic colloidal nanocrystal clusters coated with chitosan for selective enrichment of glycopeptides. Analytica Chimica Acta 2014, 841:99-105.
18Hirao Y, Matsuzaki H, Iwaki J, Kuno A, Kaji H, Ohkura T, Togayachi A, Abe M, Nomura M, Noguchi M, et al: Glycoproteomics Approach for Identifying Glycobiomarker Candidate Molecules for Tissue Type Classification of Non-small Cell Lung Carcinoma. Journal of Proteome Research 2014, 13:4705-4716.
19Huang G, Sun Z, Qin H, Zhao L, Xiong Z, Peng X, Ou J, Zou H: Preparation of hydrazine functionalized polymer brushes hybrid magnetic nanoparticles for highly specific enrichment of glycopeptides. Analyst 2014, 139:2199-2206.
22Nicastri A, Gaspari M, Sacco R, Elia L, Gabriele C, Romano R, Rizzuto A, Cuda G: N-Glycoprotein Analysis Discovers New Up-Regulated Glycoproteins in Colorectal Cancer Tissue. Journal of Proteome Research 2014, 13:4932-4941.
25Sun Z, Dong J, Zhang S, Hu Z, Cheng K, Li K, Xu B, Ye M, Nie Y, Fan D, Zou H: Identification of Chemoresistance-Related Cell-Surface Glycoproteins in Leukemia Cells and Functional Validation of Candidate Glycoproteins. Journal of Proteome Research 2014, 13:1593-1601.
32Zhang Z, Sun Z, Zhu J, Liu J, Huang G, Ye M, Zou H: High-Throughput Determination of the Site-Specific N-Sialoglycan Occupancy Rates by Differential Oxidation of Glycoproteins Followed with Quantitative Glycoproteomics Analysis. Analytical Chemistry 2014, 86:9830-9837.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
34Sun S, Zhang B, Aiyetan P, Zhou J-Y, Shah P, Yang W, Levine DA, Zhang Z, Chan DW, Zhang H: Analysis of N-glycoproteins using Genomic N-glycosite Prediction. Journal of Proteome Research 2013, 12:5609-5615.
37Boersema PJ, Geiger T, Wisniewski JR, Mann M: Quantification of the N-glycosylated Secretome by Super-SILAC During Breast Cancer Progression and in Human Blood Samples. Molecular & Cellular Proteomics 2013, 12:158-171.
38Kaji H, Ocho M, Togayachi A, Kuno A, Sogabe M, Ohkura T, Nozaki H, Angata T, Chiba Y, Ozaki H, et al: Glycoproteomic Discovery of Serological Biomarker Candidates for HCV/HBV Infection-Associated Liver Fibrosis and Hepatocellular Carcinoma. Journal of Proteome Research 2013, 12:2630-2640.
40Li X, Jiang J, Zhao X, Wang J, Han H, Zhao Y, Peng B, Zhong R, Ying W, Qian X: N-glycoproteome Analysis of the Secretome of Human Metastatic Hepatocellular Carcinoma Cell Lines Combining Hydrazide Chemistry, HILIC Enrichment and Mass Spectrometry. Plos One 2013, 8.
43Wang GG, Wu YB, Zhou T, Guo YS, Zheng B, Wang J, Bi Y, Liu FJ, Zhou ZM, Guo XJ, Sha JH: Mapping of the N-Linked Glycoproteome of Human Spermatozoa. Journal of Proteome Research 2013, 12:5750-5759.
48Danzer C, Eckhardt K, Schmidt A, Fankhauser N, Ribrioux S, Wollscheid B, Mueller L, Schiess R, Zuellig R, Lehmann R, et al: Comprehensive Description of the N-Glycoproteome of Mouse Pancreatic beta-Cells and Human Islets. Journal of Proteome Research 2012, 11:1598-1608.
50Whitmore TE, Peterson A, Holzman T, Eastham A, Amon L, McIntosh M, Ozinsky A, Nelson PS, Martin DB: Integrative Analysis of N-Linked Human Glycoproteomic Data Sets Reveals PTPRF Ectodomain as a Novel Plasma Biomarker Candidate for Prostate Cancer. Journal of Proteome Research 2012, 11:2653-2665.
52Yen T-Y, Macher BA, McDonald CA, Alleyne-Chin C, Timpe LC: Glycoprotein Profiles of Human Breast Cells Demonstrate a Clear Clustering of Normal/Benign versus Malignant Cell Lines and Basal versus Luminal Cell Lines. Journal of Proteome Research 2012, 11:656-667.
54Tian Y, Yao Z, Roden R, Zhang H: Identification of glycoproteins associated with different histological subtypes of ovarian tumors using quantitative glycoproteomics. Proteomics 2011, 11:4677-4687.
56Bandhakavi S, Van Riper SK, Tawfik PN, Stone MD, Haddad T, Rhodus NL, Carlis JV, Griffin TJ: Hexapeptide Libraries for Enhanced Protein PTM Identification and Relative Abundance Profiling in Whole Human Saliva. Journal of Proteome Research 2011, 10:1052-1061.
57Chen Y, Cao J, Yan G, Lu H, Yang P: Two-step protease digestion and glycopeptide capture approach for accurate glycosite identification and glycoprotein sequence coverage improvement. Talanta 2011, 85:70-75.
58Nagano K, Shinkawa T, Kato K, Inomata N, Yabuki N, Haramura M: Distinct cell surface proteome profiling by biotin labeling and glycoprotein capturing. Journal of Proteomics 2011, 74:1985-1993.
62Arcinas A, Yen T-Y, Kebebew E, Macher BA: Cell Surface and Secreted Protein Profiles of Human Thyroid Cancer Cell Lines Reveal Distinct Glycoprotein Patterns. Journal of Proteome Research 2009, 8:3958-3968.
63Cao J, Shen C, Wang H, Shen H, Chen Y, Nie A, Yan G, Lu H, Liu Y, Yang P: Identification of N-Glycosylation Sites on Secreted Proteins of Human Hepatocellular Carcinoma Cells with a Complementary Proteomics Approach. Journal of Proteome Research 2009, 8:662-672.
64Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res 2009, 8:651-661.
75Sun B, Ranish JA, Utleg AG, White JT, Yan X, Lin B, Hood L: Shotgun glycopeptide capture approach coupled with mass Spectrometry for comprehensive glycoproteomics. Molecular & Cellular Proteomics 2007, 6:141-149.
83Zhang H, Li XJ, Martin DB, Aebersold R: Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry. Nature Biotechnology 2003, 21:660-666.