Contains      

UniProtKB-O43852

Protein Calumenin
Gene CALU
Status Reviewed
Source 22Rv1 cell xenograft (prostate cancer); Breast Cancer cell lines; Breast cancer cell lines; Breast cancer xenografts; Breast cell lines; Breast tumor; Colorectal tumor; DLBCL cell lines (Diffuse large B-cell lymphoma); DRO-1 Cell Line (Thyroid Cance); FTC-133 Cell Line (Thyroid Cance); HCC cell lines (Liver)Jurkat T cell line; HCCLM3 cell line (Liver); HEK293 cell line (embryonic kidney); HEK293T cell line (embryonic kidney); Hela cell line (cervical cancer); HuH-7 cell line (Liver); IGROV-1/CP cell line (Ovarian cancer)IGROV-1/CP; LNCap/PC3 cell lines (Prostate cancer); Liver; OVCAR-3 cell line (Ovarian cancer); Ovarian tumor; Pancreatic islets; Plasma; Platelet; Prostate; Prostate tumor; SKOV-3 cell line (Ovarian cancer); XTC-1 Cell Line (Thyroid Cance); ovarian tumor; prostate cancer cell lines
Years 2007-2015

Glycosites

Site Identified Peptides Year(Publication ID)
131 KnATYGY 2014(33);
131 nATYGYVLD 2014(19); 2014(33);
131 EEYKnATYGY 2014(33);
131 YKnATYGYVLDD 2014(33);
131 SWEEYKnATYGYV 2013(37);
131 DLNEDGLVSWEEYKnATY 2014(33);
131 DLNEDGLVSWEEYKnATYGY 2014(33);
131 GHDLNEDGLVSWEEYKnATY 2014(33);
131 nATYGYVIDDPDPDDGFNYK 2014(16);
131 nATYGYVLDDPDPDDGFNYK 2007(72); 2007(75); 2009(62); 2009(62); 2009(63); 2009(64); 2009(66); 2011(54); 2011(57); 2012(48); 2012(50); 2012(52); 2013(34); 2013(34); 2013(34); 2013(38); 2013(40); 2014(13); 2014(14); 2014(15); 2014(22); 2014(33); 2015(1); 2015(2); 2015(12); 2015(unpublished);2015(unpublished);2015(unpublished);2007(unpublished);2007;2007;2007;
131 KGHDLNEDGLVSWEEYKnATY 2014(33);
131 GHDLNEDGLVSWEEYKnATYGY 2012(48);
131 YKnATYGYVLDDPDPDDGFNYK 2014(33);
131 EYKnATYGYVLDDPDPDDGFNYK 2014(33);
131 KGHDLNEDGLVSWEEYKnATYGY 2014(33);
131 GHDLNEDGLVSWEEYKnATYGYVL 2007(75);
131 GHDLNEDGLVSWEEYKnATYGYVLD 2007(75);
131 nATYGYVLDDPDPDDGFNYKQMMVR 2014(33);
131 GHDLNEDGLVSWEEYKnATYGYVLDD 2007(75);
131 GHDLNEDGLVSWEEYKnATYGYVLDDPDPDDGFNYK 2009(62); 2012(48); 2013(34); 2013(34); 2014(33); 2015(unpublished);2015(1); 2015(unpublished);2015(2); 2015(12);

Sequence

1112131415161718191
MDLRQFLMCLSLCTAFALSKPTEKKDRVHHEPQLSDKVHNDAQSFDYDHDAFLGAEEAKTFDQLTPEESKERLGKIVSKIDGDKDGFVTVDELKDWIKFA
101111121131141151161171181191
QKRWIYEDVERQWKGHDLNEDGLVSWEEYKNATYGYVLDDPDPDDGFNYKQMMVRDERRFKMADKDGDLIATKEEFTAFLHPEEYDYMKDIVVQETMEDI
201211221231241251261271281291
DKNADGFIDLEEYIGDMYSHDGNTDEPEWVKTEREQFVEFRDKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQNKDGKLTKEEIVDKYDLFVGS
301311
QATDFGEALVRHDEF

Reference

ID Publication
1Sun S, Shah P, Eshghi ST, Yang W, Trikannad N, Yang S, Chen L, Aiyetan P, Hoti N, Zhang Z, et al: Comprehensive analysis of protein glycosylation by solid-phase extraction of N-linked glycans and glycosite-containing peptides. Nat Biotech 2015, advance online publication.
2Shah P, Wang X, Yang W, Eshghi ST, Sun S, Hoti N, Chen L, Yang S, Pasay J, Rubin A: Integrated Proteomic and Glycoproteomic Analyses of Prostate Cancer Cells Reveal Glycoprotein Alteration in Protein Abundance and Glycosylation. Molecular & Cellular Proteomics 2015, 14:2753-2763.
12Weng Y, Sui Z, Jiang H, Shan Y, Chen L, Zhang S, Zhang L, Zhang Y: Releasing N-glycan from Peptide N-terminus by N-terminal Succinylation Assisted Enzymatic Deglycosylation. Scientific Reports 2015, 5.
13Yang W, Laeyendecker O, Wendel SK, Zhang B, Sun S, Zhou J-Y, Ao M, Moore RD, Jackson JB, Zhang H: Glycoproteomic Study Reveals Altered Plasma Proteins Associated with HIV Elite Suppressors. Theranostics 2014, 4:1153.
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
15Chen R, Seebun D, Ye M, Zou H, Figeys D: Site-specific characterization of cell membrane N-glycosylation with integrated hydrophilic interaction chromatography solid phase extraction and LC-MS/MS. Journal of Proteomics 2014, 103:194-203.
16Deeb SJ, Cox J, Schmidt-Supprian M, Mann M: N-linked Glycosylation Enrichment for In-depth Cell Surface Proteomics of Diffuse Large B-cell Lymphoma Subtypes. Molecular & Cellular Proteomics 2014, 13:240-251.
19Huang G, Sun Z, Qin H, Zhao L, Xiong Z, Peng X, Ou J, Zou H: Preparation of hydrazine functionalized polymer brushes hybrid magnetic nanoparticles for highly specific enrichment of glycopeptides. Analyst 2014, 139:2199-2206.
22Nicastri A, Gaspari M, Sacco R, Elia L, Gabriele C, Romano R, Rizzuto A, Cuda G: N-Glycoprotein Analysis Discovers New Up-Regulated Glycoproteins in Colorectal Cancer Tissue. Journal of Proteome Research 2014, 13:4932-4941.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
34Sun S, Zhang B, Aiyetan P, Zhou J-Y, Shah P, Yang W, Levine DA, Zhang Z, Chan DW, Zhang H: Analysis of N-glycoproteins using Genomic N-glycosite Prediction. Journal of Proteome Research 2013, 12:5609-5615.
37Boersema PJ, Geiger T, Wisniewski JR, Mann M: Quantification of the N-glycosylated Secretome by Super-SILAC During Breast Cancer Progression and in Human Blood Samples. Molecular & Cellular Proteomics 2013, 12:158-171.
38Kaji H, Ocho M, Togayachi A, Kuno A, Sogabe M, Ohkura T, Nozaki H, Angata T, Chiba Y, Ozaki H, et al: Glycoproteomic Discovery of Serological Biomarker Candidates for HCV/HBV Infection-Associated Liver Fibrosis and Hepatocellular Carcinoma. Journal of Proteome Research 2013, 12:2630-2640.
40Li X, Jiang J, Zhao X, Wang J, Han H, Zhao Y, Peng B, Zhong R, Ying W, Qian X: N-glycoproteome Analysis of the Secretome of Human Metastatic Hepatocellular Carcinoma Cell Lines Combining Hydrazide Chemistry, HILIC Enrichment and Mass Spectrometry. Plos One 2013, 8.
48Danzer C, Eckhardt K, Schmidt A, Fankhauser N, Ribrioux S, Wollscheid B, Mueller L, Schiess R, Zuellig R, Lehmann R, et al: Comprehensive Description of the N-Glycoproteome of Mouse Pancreatic beta-Cells and Human Islets. Journal of Proteome Research 2012, 11:1598-1608.
50Whitmore TE, Peterson A, Holzman T, Eastham A, Amon L, McIntosh M, Ozinsky A, Nelson PS, Martin DB: Integrative Analysis of N-Linked Human Glycoproteomic Data Sets Reveals PTPRF Ectodomain as a Novel Plasma Biomarker Candidate for Prostate Cancer. Journal of Proteome Research 2012, 11:2653-2665.
52Yen T-Y, Macher BA, McDonald CA, Alleyne-Chin C, Timpe LC: Glycoprotein Profiles of Human Breast Cells Demonstrate a Clear Clustering of Normal/Benign versus Malignant Cell Lines and Basal versus Luminal Cell Lines. Journal of Proteome Research 2012, 11:656-667.
54Tian Y, Yao Z, Roden R, Zhang H: Identification of glycoproteins associated with different histological subtypes of ovarian tumors using quantitative glycoproteomics. Proteomics 2011, 11:4677-4687.
57Chen Y, Cao J, Yan G, Lu H, Yang P: Two-step protease digestion and glycopeptide capture approach for accurate glycosite identification and glycoprotein sequence coverage improvement. Talanta 2011, 85:70-75.
62Arcinas A, Yen T-Y, Kebebew E, Macher BA: Cell Surface and Secreted Protein Profiles of Human Thyroid Cancer Cell Lines Reveal Distinct Glycoprotein Patterns. Journal of Proteome Research 2009, 8:3958-3968.
63Cao J, Shen C, Wang H, Shen H, Chen Y, Nie A, Yan G, Lu H, Liu Y, Yang P: Identification of N-Glycosylation Sites on Secreted Proteins of Human Hepatocellular Carcinoma Cells with a Complementary Proteomics Approach. Journal of Proteome Research 2009, 8:662-672.
64Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res 2009, 8:651-661.
66Jia W, Lu Z, Fu Y, Wang H-P, Wang L-H, Chi H, Yuan Z-F, Zheng Z-B, Song L-N, Han H-H, et al: A Strategy for Precise and Large Scale Identification of Core Fucosylated Glycoproteins. Molecular & Cellular Proteomics 2009, 8:913-923.
72Hanson SR, Hsu T-L, Weerapana E, Kishikawa K, Simon GM, Cravatt BF, Wong C-H: Tailored glycoproteomics and glycan site mapping using saccharide-selective bioorthogonal probes. Journal of the American Chemical Society 2007, 129:7266-+.
75Sun B, Ranish JA, Utleg AG, White JT, Yan X, Lin B, Hood L: Shotgun glycopeptide capture approach coupled with mass Spectrometry for comprehensive glycoproteomics. Molecular & Cellular Proteomics 2007, 6:141-149.