Contains      

UniProtKB-O75954

Protein Tetraspanin-9
Gene TSPAN9
Status Reviewed
Source Breast cancer xenografts; Colorectal cancer cell line, HCT-116 (colorectal cancer); Colorectal tumor; HCC cell lines (Liver); Hela cell line (cervical cancer); LNCap/PC3 cell lines (Prostate cancer); Liver; Ovarian tumor; Platelet; Platelet Plasma membranes
Years 2007-2015

Glycosites

Site Identified Peptides Year(Publication ID)
180 nATTPLWR 2007(74); 2011(58); 2013(40); 2014(22); 2014(33); 2015(unpublished);2015(unpublished);2015(2); 2015(unpublished);2015(12);

Sequence

1112131415161718191
MARGCLCCLKYMMFLFNLIFWLCGCGLLGVGIWLSVSQGNFATFSPSFPSLSAANLVIAIGTIVMVTGFLGCLGAIKENKCLLLSFFIVLLVILLAELIL
101111121131141151161171181191
LILFFVYMDKVNENAKKDLKEGLLLYHTENNVGLKNAWNIIQAEMRCCGVTDYTDWYPVLGENTVPDRCCMENSQGCGRNATTPLWRTGCYEKVKMWFDD
201211221231
NKHVLGTVGMCILIMQILGMAFSMTLFQHIHRTGKKYDA

Reference

ID Publication
2Shah P, Wang X, Yang W, Eshghi ST, Sun S, Hoti N, Chen L, Yang S, Pasay J, Rubin A: Integrated Proteomic and Glycoproteomic Analyses of Prostate Cancer Cells Reveal Glycoprotein Alteration in Protein Abundance and Glycosylation. Molecular & Cellular Proteomics 2015, 14:2753-2763.
12Weng Y, Sui Z, Jiang H, Shan Y, Chen L, Zhang S, Zhang L, Zhang Y: Releasing N-glycan from Peptide N-terminus by N-terminal Succinylation Assisted Enzymatic Deglycosylation. Scientific Reports 2015, 5.
22Nicastri A, Gaspari M, Sacco R, Elia L, Gabriele C, Romano R, Rizzuto A, Cuda G: N-Glycoprotein Analysis Discovers New Up-Regulated Glycoproteins in Colorectal Cancer Tissue. Journal of Proteome Research 2014, 13:4932-4941.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
40Li X, Jiang J, Zhao X, Wang J, Han H, Zhao Y, Peng B, Zhong R, Ying W, Qian X: N-glycoproteome Analysis of the Secretome of Human Metastatic Hepatocellular Carcinoma Cell Lines Combining Hydrazide Chemistry, HILIC Enrichment and Mass Spectrometry. Plos One 2013, 8.
58Nagano K, Shinkawa T, Kato K, Inomata N, Yabuki N, Haramura M: Distinct cell surface proteome profiling by biotin labeling and glycoprotein capturing. Journal of Proteomics 2011, 74:1985-1993.
74Lewandrowski U, Zahedi RP, Moebius J, Walter U, Sickmann A: Enhanced N-glycosylation site analysis of Sialoglycopeptides by strong cation exchange prefractionation applied to platelet plasma membranes. Molecular & Cellular Proteomics 2007, 6:1933-1941.