Contains      

UniProtKB-O75976

Protein Carboxypeptidase D
Gene CPD
Status Reviewed
Source 22Rv1 cell xenograft (prostate cancer); ARO Cell Line (Thyroid Cance); Breast Cancer cell lines; Breast cancer cell lines; Breast cancer xenografts; Breast cell lines; Breast tumor; Colorectal cancer cell line, HCT-116 (colorectal cancer); Colorectal tumor; DLBCL cell lines (Diffuse large B-cell lymphoma); HCC cell lines (Liver); HCC cell lines (Liver)Jurkat T cell line; HEK293 cell line (embryonic kidney); HEK293T cell line (embryonic kidney); HEK293T cell line (embryonic kidney), HEK293T cell line (embryonic kidney); Hela cell line (cervical cancer); HuH-7 cell line (Liver); IGROV-1/CP cell line (Ovarian cancer)IGROV-1/CP; Jurkat T cell line; K562A cell line (Leukemia); LNCap/PC3 cell lines (Prostate cancer); Liver; Liver tumor (HCC); LnCap cell line (Prostate cancer); Non-small Cell Lung Carcinoma; OVCAR-3 cell line (Ovarian cancer); Ovarian cancer cell lines; Ovarian tumor; Pancreatic islets; Prostate; Prostate cancer cell lines; Prostate tumor; SKOV-3 cell line (Ovarian cancer); SKOV-3 cell line (Ovarian cancer)Jurkat T cell line; SW1990 cell line (Pancreatic cancer); Saliva; Serum; Spermatozoa; TPC-1 Cell Line (Thyroid Cance); Urine; XTC-1 Cell Line (Thyroid Cance); ovarian tumor; prostate cancer cell lines
Years 2003-2015

Glycosites

Site Identified Peptides Year(Publication ID)
172 VRLLnTTDVY 2014(33);
172 RIVRIInTTDVYI 2013(37);
172 IInTTDVYIIPSINPDGFER 2013(43); 2014(32); 2014(32);
172 LLnTTDVYLLPSLNPDGFER 2003( 83); 2007(72); 2007(75); 2007(62); 2009(62); 2009(62); 2009(56); 2011(48); 2012(52); 2012(34); 2013(34); 2013(34); 2013(40); 2013(14); 2014(15); 2014(25); 2014(33); 2014(1); 2015(2); 2015(3); 2015(12); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2007(unpublished);2007(unpublished);2007;2007;2007;2007;2007;2007;
172 LLnTTDVYLLPSLNPDGFERAR 2014(18);
399 nATISVAGINH 2015(1);
399 DSITGSGIEnATISVAGINHNITTGR 2013(43); 2014(16); 2014(32); 2014(32);
399 DSITGSGLEnATISVAGINHNITTGR 2007(75); 2009(62); 2012(48); 2012(52); 2013(34); 2013(34); 2013(40); 2014(14); 2014(22); 2014(25); 2014(33); 2015(1); 2015(2); 2015(12); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2007;2007;2007;2007;2007;
399 GFVKDSITGSGLEnATISVAGINHNITTGR 2015(1); 2015(2);
410 GINHnITTGR 2012(48);
410 DSITGSGIENATISVAGINHnITTGR 2013(43); 2014(16); 2014(32); 2014(32);
410 DSITGSGLENATISVAGINHnITTGR 2007(75); 2009(62); 2012(48); 2012(52); 2013(34); 2013(34); 2013(40); 2014(14); 2014(22); 2014(25); 2014(33); 2015(1); 2015(2); 2015(12); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2007;2007;2007;2007;2007;
410 GFVKDSITGSGLENATISVAGINHnITTGR 2015(1); 2015(2);
429 LLVPGTYnLTVV 2007(unpublished);2007(unpublished);2007(unpublished);
429 LLVPGTYnLTVVLTGYMPLTVTNVVVK 2015(2);
522 NEYPnITR 2012(48);
522 ANEYPnITR 2012(48);
522 FANEYPnITR 2007(72); 2007(75); 2007(62); 2009(62); 2009(55); 2011(57); 2011(48); 2012(34); 2013(34); 2013(38); 2013(40); 2013(13); 2014(14); 2014(15); 2014(16); 2014(17); 2014(18); 2014(22); 2014(33); 2014(1); 2015(2); 2015(3); 2015(12); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2007;2007;2007;2007;2007;2007;
522 ANEYPnITRLY 2014(33);
522 RFANEYPnITR 2007(72); 2011(57); 2012(48); 2013(34); 2013(34); 2013(38); 2013(43); 2014(13); 2014(15); 2014(33); 2015(1); 2015(2); 2015(unpublished);2015(12);
522 FANEYPnITRIYS 2013(37);
626 nNSNNFDLNR 2011(57); 2012(52); 2013(40); 2014(14); 2014(15); 2014(33); 2015(unpublished);2015(2); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(12);
626 ISVIGRnNSNNFD 2013(37);
811 GILnATISVAE 2014(33);
811 DGRGIInATISVA 2013(37);
811 nATISVAEINHPVTTY 2014(33);
811 nATISVAEINHPVTTYK 2015(1);
811 nATLSVAEINHPVTTYK 2012(48);
811 LnATLSVAEINHPVTTYK 2012(48);
811 GILnATISVAEINHPVTTY 2011(57); 2014(33);
811 GIInATISVAEINHPVTTYK 2013(43); 2014(16); 2014(32);
811 GILnATISVAEINHPVTTYK 2003( 83); 2007(75); 2007(62); 2009(64); 2009(57); 2011(48); 2012(52); 2012(34); 2013(34); 2013(40); 2013(33); 2014(1); 2015(2); 2015(9); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2007;2007;2007;2007;2007;
811 GILnATLSVAEINHPVTTYK 2012(48);
855 nVTVKS 2011(56);
855 GYNPVTKnVTVK 2007(72); 2013(34); 2013(34); 2014(15); 2014(16); 2015(2);
867 SEGAIQVnF 2014(33);
867 EGAIQVnFTIVRS 2013(37);
867 SEGAIQVnFTIVR 2013(43); 2014(16); 2014(32);
867 SEGAIQVnFTLVR 2009(62); 2012(52); 2014(33); 2015(1); 2015(2); 2015(unpublished);2015(unpublished);2015;2015;2007;2007;
955 nLTNLGQSTEYR 2015(1);
955 NYPHITnITNIGQ 2013(37);
955 ITnLTNLGQSTEYR 2012(48); 2014(33);
955 NYPHITnLTNLGQSTEYR 2011(57);
955 GIVMNYPHITnITNIGQSTEYR 2013(43); 2014(16);
955 GLVMNYPHITnLTNLGQSTEYR 2003( 83); 2007(75); 2007(64); 2009(48); 2012(52); 2012(34); 2013(34); 2013(34); 2013(25); 2014(33); 2014(1); 2015(2); 2015(12); 2015(unpublished);2015(unpublished);2015(unpublished);2007(unpublished);2007(unpublished);2007(unpublished);2007(unpublished);2007;2007;2007;
978 nVSEPEEPK 2015(1);
978 ISNKPnVSEPEEPK 2014(33);
978 SLEISNKPnVSEPEEPK 2011(57); 2014(33);
978 HIWSIEISNKPnVSEPEEPK 2014(16);
978 HIWSLEISNKPnVSEPEEPK 2011(58); 2012(48); 2013(38); 2013(40); 2014(33); 2015(9); 2015(12);
978 SLEISNKPnVSEPEEPKIRF 2014(33);
978 HIWSIEISNKPnVSEPEEPKIR 2013(43);
1070 nASQPETK 2015(1);
1070 FTNnASQPETKA 2009(64);
1070 DTDFTNnASQPET 2013(37);
1070 DIDTDFTNnASQPETK 2014(16);
1070 DLDTDFTNnASQPETK 2007(75); 2011(54); 2011(57); 2012(47); 2012(48); 2012(50); 2012(52); 2013(34); 2014(13); 2014(14); 2014(22); 2014(33); 2015(1); 2015(2); 2015(unpublished);2015(unpublished);2015(unpublished);2007(unpublished);2007;2007;2007;
1070 GKDLDTDFTNnASQPE 2014(33);
1070 GKDIDTDFTNnASQPETK 2013(43); 2014(16);
1070 GKDLDTDFTNnASQPETK 2007(unpublished);2007(75); 2011(58); 2012(52); 2013(34); 2013(34); 2013(34); 2014(13); 2014(14); 2014(15); 2014(17); 2014(18); 2014(25); 2014(33); 2015(unpublished);2015(1); 2015(2); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(12);
1142 nKSDENIPGGVMR 2015(1);
1142 HIASIYANNHPSMHMGQPSCPnKSDENIPGGVMR 2014(16);

Sequence

1112131415161718191
MASGRDERPPWRLGRLLLLMCLLLLGSSARAAHIKKAEATTTTTSAGAEAAEGQFDRYYHEEELESALREAAAAGLPGLARLFSIGRSVEGRPLWVLRLT
101111121131141151161171181191
AGLGSLIPEGDAGPDAAGPDAAGPLLPGRPQVKLVGNMHGDETVSRQVLIYLARELAAGYRRGDPRLVRLLNTTDVYLLPSLNPDGFERAREGDCGFGDG
201211221231241251261271281291
GPSGASGRDNSRGRDLNRSFPDQFSTGEPPALDEVPEVRALIEWIRRNKFVLSGNLHGGSVVASYPFDDSPEHKATGIYSKTSDDEVFKYLAKAYASNHP
301311321331341351361371381391
IMKTGEPHCPGDEDETFKDGITNGAHWYDVEGGMQDYNYVWANCFEITLELSCCKYPPASQLRQEWENNRESLITLIEKVHIGVKGFVKDSITGSGLENA
401411421431441451461471481491
TISVAGINHNITTGRFGDFYRLLVPGTYNLTVVLTGYMPLTVTNVVVKEGPATEVDFSLRPTVTSVIPDTTEAVSTASTVAIPNILSGTSSSYQPIQPKD
501511521531541551561571581591
FHHHHFPDMEIFLRRFANEYPNITRLYSLGKSVESRELYVMEISDNPGVHEPGEPEFKYIGNMHGNEVVGRELLLNLIEYLCKNFGTDPEVTDLVHNTRI
601611621631641651661671681691
HLMPSMNPDGYEKSQEGDSISVIGRNNSNNFDLNRNFPDQFVQITDPTQPETIAVMSWMKSYPFVLSANLHGGSLVVNYPFDDDEQGLATYSKSPDDAVF
701711721731741751761771781791
QQIALSYSKENSQMFQGRPCKNMYPNEYFPHGITNGASWYNVPGGMQDWNYLQTNCFEVTIELGCVKYPLEKELPNFWEQNRRSLIQFMKQVHQGVRGFV
801811821831841851861871881891
LDATDGRGILNATISVAEINHPVTTYKTGDYWRLLVPGTYKITASARGYNPVTKNVTVKSEGAIQVNFTLVRSSTDSNNESKKGKGASSSTNDASDPTTK
901911921931941951961971981991
EFETLIKDLSAENGLESLMLRSSSNLALALYRYHSYKDLSEFLRGLVMNYPHITNLTNLGQSTEYRHIWSLEISNKPNVSEPEEPKIRFVAGIHGNAPVG
1001101110211031104110511061107110811091
TELLLALAEFLCLNYKKNPAVTQLVDRTRIVIVPSLNPDGRERAQEKDCTSKIGQTNARGKDLDTDFTNNASQPETKAIIENLIQKQDFSLSVALDGGSM
1101111111211131114111511161117111811191
LVTYPYDKPVQTVENKETLKHLASLYANNHPSMHMGQPSCPNKSDENIPGGVMRGAEWHSHLGSMKDYSVTYGHCPEITVYTSCCYFPSAARLPSLWADN
1201121112211231124112511261127112811291
KRSLLSMLVEVHKGVHGFVKDKTGKPISKAVIVLNEGIKVQTKEGGYFHVLLAPGVHNIIAIADGYQQQHSQVFVHHDAASSVVIVFDTDNRIFGLPREL
13011311132113311341135113611371
VVTVSGATMSALILTACIIWCICSIKSNRHKDGFHRLRQHHDEYEDEIRMMSTGSKKSLLSHEFQDETDTEEETLYSSKH

Reference

ID Publication
1Sun S, Shah P, Eshghi ST, Yang W, Trikannad N, Yang S, Chen L, Aiyetan P, Hoti N, Zhang Z, et al: Comprehensive analysis of protein glycosylation by solid-phase extraction of N-linked glycans and glycosite-containing peptides. Nat Biotech 2015, advance online publication.
2Shah P, Wang X, Yang W, Eshghi ST, Sun S, Hoti N, Chen L, Yang S, Pasay J, Rubin A: Integrated Proteomic and Glycoproteomic Analyses of Prostate Cancer Cells Reveal Glycoprotein Alteration in Protein Abundance and Glycosylation. Molecular & Cellular Proteomics 2015, 14:2753-2763.
3Tian Y, Almaraz RT, Choi CH, Li QK, Saeui C, Li D, Shah P, Bhattacharya R, Yarema KJ, Zhang H: Identification of sialylated glycoproteins from metabolically oligosaccharide engineered pancreatic cells. Clinical proteomics 2015, 12:11.
9Smeekens JM, Chen WX, Wu RH: Mass Spectrometric Analysis of the Cell Surface N-Glycoproteome by Combining Metabolic Labeling and Click Chemistry. Journal of the American Society for Mass Spectrometry 2015, 26:604-614.
12Weng Y, Sui Z, Jiang H, Shan Y, Chen L, Zhang S, Zhang L, Zhang Y: Releasing N-glycan from Peptide N-terminus by N-terminal Succinylation Assisted Enzymatic Deglycosylation. Scientific Reports 2015, 5.
13Yang W, Laeyendecker O, Wendel SK, Zhang B, Sun S, Zhou J-Y, Ao M, Moore RD, Jackson JB, Zhang H: Glycoproteomic Study Reveals Altered Plasma Proteins Associated with HIV Elite Suppressors. Theranostics 2014, 4:1153.
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
15Chen R, Seebun D, Ye M, Zou H, Figeys D: Site-specific characterization of cell membrane N-glycosylation with integrated hydrophilic interaction chromatography solid phase extraction and LC-MS/MS. Journal of Proteomics 2014, 103:194-203.
16Deeb SJ, Cox J, Schmidt-Supprian M, Mann M: N-linked Glycosylation Enrichment for In-depth Cell Surface Proteomics of Diffuse Large B-cell Lymphoma Subtypes. Molecular & Cellular Proteomics 2014, 13:240-251.
17Fang C, Xiong Z, Qin H, Huang G, Liu J, Ye M, Feng S, Zou H: One-pot synthesis of magnetic colloidal nanocrystal clusters coated with chitosan for selective enrichment of glycopeptides. Analytica Chimica Acta 2014, 841:99-105.
18Hirao Y, Matsuzaki H, Iwaki J, Kuno A, Kaji H, Ohkura T, Togayachi A, Abe M, Nomura M, Noguchi M, et al: Glycoproteomics Approach for Identifying Glycobiomarker Candidate Molecules for Tissue Type Classification of Non-small Cell Lung Carcinoma. Journal of Proteome Research 2014, 13:4705-4716.
22Nicastri A, Gaspari M, Sacco R, Elia L, Gabriele C, Romano R, Rizzuto A, Cuda G: N-Glycoprotein Analysis Discovers New Up-Regulated Glycoproteins in Colorectal Cancer Tissue. Journal of Proteome Research 2014, 13:4932-4941.
25Sun Z, Dong J, Zhang S, Hu Z, Cheng K, Li K, Xu B, Ye M, Nie Y, Fan D, Zou H: Identification of Chemoresistance-Related Cell-Surface Glycoproteins in Leukemia Cells and Functional Validation of Candidate Glycoproteins. Journal of Proteome Research 2014, 13:1593-1601.
32Zhang Z, Sun Z, Zhu J, Liu J, Huang G, Ye M, Zou H: High-Throughput Determination of the Site-Specific N-Sialoglycan Occupancy Rates by Differential Oxidation of Glycoproteins Followed with Quantitative Glycoproteomics Analysis. Analytical Chemistry 2014, 86:9830-9837.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
34Sun S, Zhang B, Aiyetan P, Zhou J-Y, Shah P, Yang W, Levine DA, Zhang Z, Chan DW, Zhang H: Analysis of N-glycoproteins using Genomic N-glycosite Prediction. Journal of Proteome Research 2013, 12:5609-5615.
37Boersema PJ, Geiger T, Wisniewski JR, Mann M: Quantification of the N-glycosylated Secretome by Super-SILAC During Breast Cancer Progression and in Human Blood Samples. Molecular & Cellular Proteomics 2013, 12:158-171.
38Kaji H, Ocho M, Togayachi A, Kuno A, Sogabe M, Ohkura T, Nozaki H, Angata T, Chiba Y, Ozaki H, et al: Glycoproteomic Discovery of Serological Biomarker Candidates for HCV/HBV Infection-Associated Liver Fibrosis and Hepatocellular Carcinoma. Journal of Proteome Research 2013, 12:2630-2640.
40Li X, Jiang J, Zhao X, Wang J, Han H, Zhao Y, Peng B, Zhong R, Ying W, Qian X: N-glycoproteome Analysis of the Secretome of Human Metastatic Hepatocellular Carcinoma Cell Lines Combining Hydrazide Chemistry, HILIC Enrichment and Mass Spectrometry. Plos One 2013, 8.
43Wang GG, Wu YB, Zhou T, Guo YS, Zheng B, Wang J, Bi Y, Liu FJ, Zhou ZM, Guo XJ, Sha JH: Mapping of the N-Linked Glycoproteome of Human Spermatozoa. Journal of Proteome Research 2013, 12:5750-5759.
47Almaraz RT, Tian Y, Bhattarcharya R, Tan E, Chen S-H, Dallas MR, Chen L, Zhang Z, Zhang H, Konstantopoulos K: Metabolic flux increases glycoprotein sialylation: implications for cell adhesion and cancer metastasis. Molecular & Cellular Proteomics 2012, 11:M112. 017558.
48Danzer C, Eckhardt K, Schmidt A, Fankhauser N, Ribrioux S, Wollscheid B, Mueller L, Schiess R, Zuellig R, Lehmann R, et al: Comprehensive Description of the N-Glycoproteome of Mouse Pancreatic beta-Cells and Human Islets. Journal of Proteome Research 2012, 11:1598-1608.
50Whitmore TE, Peterson A, Holzman T, Eastham A, Amon L, McIntosh M, Ozinsky A, Nelson PS, Martin DB: Integrative Analysis of N-Linked Human Glycoproteomic Data Sets Reveals PTPRF Ectodomain as a Novel Plasma Biomarker Candidate for Prostate Cancer. Journal of Proteome Research 2012, 11:2653-2665.
52Yen T-Y, Macher BA, McDonald CA, Alleyne-Chin C, Timpe LC: Glycoprotein Profiles of Human Breast Cells Demonstrate a Clear Clustering of Normal/Benign versus Malignant Cell Lines and Basal versus Luminal Cell Lines. Journal of Proteome Research 2012, 11:656-667.
54Tian Y, Yao Z, Roden R, Zhang H: Identification of glycoproteins associated with different histological subtypes of ovarian tumors using quantitative glycoproteomics. Proteomics 2011, 11:4677-4687.
55Tian Y, Bova GS, Zhang H: Quantitative glycoproteomic analysis of optimal cutting temperature-embedded frozen tissues identifying glycoproteins associated with aggressive prostate cancer. Analytical chemistry 2011, 83:7013-7019.
56Bandhakavi S, Van Riper SK, Tawfik PN, Stone MD, Haddad T, Rhodus NL, Carlis JV, Griffin TJ: Hexapeptide Libraries for Enhanced Protein PTM Identification and Relative Abundance Profiling in Whole Human Saliva. Journal of Proteome Research 2011, 10:1052-1061.
57Chen Y, Cao J, Yan G, Lu H, Yang P: Two-step protease digestion and glycopeptide capture approach for accurate glycosite identification and glycoprotein sequence coverage improvement. Talanta 2011, 85:70-75.
58Nagano K, Shinkawa T, Kato K, Inomata N, Yabuki N, Haramura M: Distinct cell surface proteome profiling by biotin labeling and glycoprotein capturing. Journal of Proteomics 2011, 74:1985-1993.
62Arcinas A, Yen T-Y, Kebebew E, Macher BA: Cell Surface and Secreted Protein Profiles of Human Thyroid Cancer Cell Lines Reveal Distinct Glycoprotein Patterns. Journal of Proteome Research 2009, 8:3958-3968.
64Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res 2009, 8:651-661.
72Hanson SR, Hsu T-L, Weerapana E, Kishikawa K, Simon GM, Cravatt BF, Wong C-H: Tailored glycoproteomics and glycan site mapping using saccharide-selective bioorthogonal probes. Journal of the American Chemical Society 2007, 129:7266-+.
75Sun B, Ranish JA, Utleg AG, White JT, Yan X, Lin B, Hood L: Shotgun glycopeptide capture approach coupled with mass Spectrometry for comprehensive glycoproteomics. Molecular & Cellular Proteomics 2007, 6:141-149.