Contains      

UniProtKB-O76096

Protein Cystatin-F
Gene CST7
Status Reviewed
Source DLBCL cell lines (Diffuse large B-cell lymphoma); Jurkat T cell line; Liver; Non-small Cell Lung Carcinoma; Prostate; Prostate tumor
Years 2014-2015

Glycosites

Site Identified Peptides Year(Publication ID)
62 FNnCTNDMFIFK 2014(16);
62 FNnCTNDMFLFK 2014(14); 2014(18); 2014(33); 2015(unpublished);
62 FNnCTNDMFLFKESR 2014(18);
62 YSVEKFNnCTNDMFLFK 2014(18);
115 DDCDFQTnHTLK 2014(14);
115 IDDCDFQTnHTIK 2014(16);
115 LDDCDFQTnHTLK 2014(13); 2014(14); 2014(18); 2014(33); 2015(unpublished);

Sequence

1112131415161718191
MRAAGTLLAFCCLVLSTTGGPSPDTCSQDLNSRVKPGFPKTIKTNDPGVLQAARYSVEKFNNCTNDMFLFKESRITRALVQIVKGLKYMLEVEIGRTTCK
101111121131141
KNQHLRLDDCDFQTNHTLKQTLSCYSEVWVVPWLQHFEVPVLRCH

Reference

ID Publication
13Yang W, Laeyendecker O, Wendel SK, Zhang B, Sun S, Zhou J-Y, Ao M, Moore RD, Jackson JB, Zhang H: Glycoproteomic Study Reveals Altered Plasma Proteins Associated with HIV Elite Suppressors. Theranostics 2014, 4:1153.
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
16Deeb SJ, Cox J, Schmidt-Supprian M, Mann M: N-linked Glycosylation Enrichment for In-depth Cell Surface Proteomics of Diffuse Large B-cell Lymphoma Subtypes. Molecular & Cellular Proteomics 2014, 13:240-251.
18Hirao Y, Matsuzaki H, Iwaki J, Kuno A, Kaji H, Ohkura T, Togayachi A, Abe M, Nomura M, Noguchi M, et al: Glycoproteomics Approach for Identifying Glycobiomarker Candidate Molecules for Tissue Type Classification of Non-small Cell Lung Carcinoma. Journal of Proteome Research 2014, 13:4705-4716.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.