Contains      

UniProtKB-O95084

Protein Serine protease 23
Gene PRSS23
Status Reviewed
Source Breast Cancer cell lines; Breast cancer xenografts; Colorectal tumor; HCC cell lines (Liver); HCCLM3 cell line (Liver); Liver; Non-small Cell Lung Carcinoma; OVCAR-3 cell line (Ovarian cancer); Ovarian tumor; Pancreatic islets; Platelet; Prostate tumor; SKOV-3 cell line (Ovarian cancer); Saliva; Urine; ovarian tumor; umbilical vein Endothelial Cells
Years 2007-2015

Glycosites

Site Identified Peptides Year(Publication ID)
93 YETIYAnGSRTET 2013(37);
93 QYLSYETLYAnGSR 2007(63); 2009(40); 2013(44); 2013(18); 2014(33); 2014(1); 2015(unpublished);2015(unpublished);2015(unpublished);2015;2015;2015;2007;2007;2007;
93 GTPLPTYEEAKQYLSYETLYAnGSR 2014(18);
93 QYLSYETLYAnGSRTETQVGIYILSSSGDGAQHR 2014(18);
207 DGGRGAnDSTSAM 2013(37);
207 GAnDSTSAMPEQMK 2011(54); 2011(56); 2012(48); 2013(34); 2013(34); 2013(40); 2014(18); 2014(22); 2015(unpublished);2007(unpublished);2007;
207 GAnDSTSAMPEQMKFQWIR 2014(18);
349 nGSPQDFNVAVR 2015(1);

Sequence

1112131415161718191
MAGIPGLLFLLFFLLCAVGQVSPYSAPWKPTWPAYRLPVVLPQSTLNLAKPDFGAEAKLEVSSSCGPQCHKGTPLPTYEEAKQYLSYETLYANGSRTETQ
101111121131141151161171181191
VGIYILSSSGDGAQHRDSGSSGKSRRKRQIYGYDSRFSIFGKDFLLNYPFSTSVKLSTGCTGTLVAEKHVLTAAHCIHDGKTYVKGTQKLRVGFLKPKFK
201211221231241251261271281291
DGGRGANDSTSAMPEQMKFQWIRVKRTHVPKGWIKGNANDIGMDYDYALLELKKPHKRKFMKIGVSPPAKQLPGGRIHFSGYDNDRPGNLVYRFCDVKDE
301311321331341351361371381
TYDLLYQQCDAQPGASGSGVYVRMWKRQQQKWERKIIGIFSGHQWVDMNGSPQDFNVAVRITPLKYAQICYWIKGNYLDCREG

Reference

ID Publication
1Sun S, Shah P, Eshghi ST, Yang W, Trikannad N, Yang S, Chen L, Aiyetan P, Hoti N, Zhang Z, et al: Comprehensive analysis of protein glycosylation by solid-phase extraction of N-linked glycans and glycosite-containing peptides. Nat Biotech 2015, advance online publication.
18Hirao Y, Matsuzaki H, Iwaki J, Kuno A, Kaji H, Ohkura T, Togayachi A, Abe M, Nomura M, Noguchi M, et al: Glycoproteomics Approach for Identifying Glycobiomarker Candidate Molecules for Tissue Type Classification of Non-small Cell Lung Carcinoma. Journal of Proteome Research 2014, 13:4705-4716.
22Nicastri A, Gaspari M, Sacco R, Elia L, Gabriele C, Romano R, Rizzuto A, Cuda G: N-Glycoprotein Analysis Discovers New Up-Regulated Glycoproteins in Colorectal Cancer Tissue. Journal of Proteome Research 2014, 13:4932-4941.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
34Sun S, Zhang B, Aiyetan P, Zhou J-Y, Shah P, Yang W, Levine DA, Zhang Z, Chan DW, Zhang H: Analysis of N-glycoproteins using Genomic N-glycosite Prediction. Journal of Proteome Research 2013, 12:5609-5615.
37Boersema PJ, Geiger T, Wisniewski JR, Mann M: Quantification of the N-glycosylated Secretome by Super-SILAC During Breast Cancer Progression and in Human Blood Samples. Molecular & Cellular Proteomics 2013, 12:158-171.
40Li X, Jiang J, Zhao X, Wang J, Han H, Zhao Y, Peng B, Zhong R, Ying W, Qian X: N-glycoproteome Analysis of the Secretome of Human Metastatic Hepatocellular Carcinoma Cell Lines Combining Hydrazide Chemistry, HILIC Enrichment and Mass Spectrometry. Plos One 2013, 8.
44Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M: Glycoproteomic Analysis of the Secretome of Human Endothelial Cells. Molecular & Cellular Proteomics 2013, 12:956-978.
48Danzer C, Eckhardt K, Schmidt A, Fankhauser N, Ribrioux S, Wollscheid B, Mueller L, Schiess R, Zuellig R, Lehmann R, et al: Comprehensive Description of the N-Glycoproteome of Mouse Pancreatic beta-Cells and Human Islets. Journal of Proteome Research 2012, 11:1598-1608.
54Tian Y, Yao Z, Roden R, Zhang H: Identification of glycoproteins associated with different histological subtypes of ovarian tumors using quantitative glycoproteomics. Proteomics 2011, 11:4677-4687.
56Bandhakavi S, Van Riper SK, Tawfik PN, Stone MD, Haddad T, Rhodus NL, Carlis JV, Griffin TJ: Hexapeptide Libraries for Enhanced Protein PTM Identification and Relative Abundance Profiling in Whole Human Saliva. Journal of Proteome Research 2011, 10:1052-1061.
63Cao J, Shen C, Wang H, Shen H, Chen Y, Nie A, Yan G, Lu H, Liu Y, Yang P: Identification of N-Glycosylation Sites on Secreted Proteins of Human Hepatocellular Carcinoma Cells with a Complementary Proteomics Approach. Journal of Proteome Research 2009, 8:662-672.