Contains      

UniProtKB-P00751

Protein Complement factor B
Gene CFB
Status Reviewed
Source Bladder tumor; Breast Cancer cell lines; Breast tumor; Cerebrospinal fluid; Colorectal tumor; HEK293 cell line (embryonic kidney); HepG2 cell line (Liver); Liver; Liver tumor (HCC); Lung tumor; Non-small Cell Lung Carcinoma; Ovarian tumor; Pancreatic islets; Plasma; Platelet; Prostate; Prostate cancer metastasis to liver; Prostate tumor; Serum; Serum (Colorectal cancer); Serum (HCC); Urine; ovarian tumor; plasma
Years 2005-20072007

Glycosites

Site Identified Peptides Year(Publication ID)
122 nVSDEISFH 2014(33);
122 SPYYnVSDE 2014(33);
122 YnVSDEISF 2014(33);
122 SPYYnVSDEI 2014(14); 2015(unpublished);
122 YnVSDEISFH 2014(33);
122 nVSDEISFHCY 2014(33);
122 SPYYnVSDEISF 2014(33);
122 YnVSDEISFHCY 2014(33);
122 PRSPYYnVSDEIS 2013(37);
122 SPYYnVSDEISFH 2007(unpublished);2014(33); 2015(unpublished);
122 YWPRSPYYnVSDE 2013(42);
122 YnVSDEISFHCYDGY 2014(33);
122 SPYYnVSDEISFHCYDGY 2014(33); 2015(unpublished);
122 SPYYnVSDEISFHCYDGYTIR 2014(32); 2014(32);
122 SPYYnVSDEISFHCYDGYTLR 2005( 81); 2010(40); 2012(53); 2013(34); 2013(38); 2013(38); 2013(38); 2013(42); 2013(45); 2014(13); 2014(35); 2014(15); 2014(18); 2014(26); 2014(33); 2015(5); 2015(10); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2007(UnpublishedUnpublished ); 2007;2007;2007;2007;20072007 ;
122 RSPYYnVSDEISFHCYDGYTLR 2015(unpublished);
142 TLRGSAnRTCQ 2014(33);
142 GSAnRTCQVNGR 2014(22); 2007(unpublished);2007(unpublished);2007(unpublished);
285 VLDGSDSIGASnF 2014(33);
285 GSDSIGASnFTGAK 2014(14); 2014(33);
285 LVLDGSDSIGASnF 2012(49); 2014(33);
285 DGSDSIGASnFTGAK 2014(14); 2014(33); 2015(unpublished);
285 LDGSDSIGASnFTGAK 2007(unpublished);2014(14); 2015(unpublished);
285 VLDGSDSIGASnFTGAK 2014(14); 2014(33);
285 LVLDGSDSIGASnFTGAK 2010(60); 2012(48); 2014(14); 2014(21); 2014(28); 2014(33); 2015(unpublished);2015(unpublished);2015(5);
285 LVLDGSDSIGASnFTGAKK 2014(33);
285 YLVLDGSDSIGASnFTGAK 2015(unpublished);
285 IYLVLDGSDSIGASnFTGAK 2015(unpublished);
285 IVIDPSGSMNIYIVIDGSDSIGASnFTGAK 2014(32);
285 IVLDPSGSMNIYLVLDGSDSIGASnFTGAK 2005( 81); 2009(64); 2010(40); 2011(54); 2012(53); 2013(45); 2014(13); 2014(14); 2014(35); 2014(15); 2014(31); 2014(33); 2015(10); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2007(unpublished);2007(UnpublishedUnpublished ); 2007;2007;2007;20072007 ;
285 IVLDPSGSMNIYLVLDGSDSIGASnFTGAKK 2013(38); 2013(38); 2014(31); 2015(unpublished);
285 KIVLDPSGSMNIYLVLDGSDSIGASnFTGAK 2009(64); 2012(53); 2013(38); 2013(45); 2014(13); 2014(35); 2014(15); 2014(18); 2014(31); 2015(unpublished);2015(unpublished);2015(unpublished);
285 KIVLDPSGSMNIYLVLDGSDSIGASnFTGAKK 2013(38); 2014(18); 2014(31); 2015(unpublished);2015(unpublished);
378 SWPDDVPPEGWnR 2014(33);
378 SMMSWPDDVPPEGWnR 2014(33);
378 ALQAVYSMMSWPDDVPPEGWnR 2012(53); 2013(38); 2013(42); 2013(45); 2014(35); 2014(33); 2015(unpublished);2007(unpublished);2007;
378 KALQAVYSMMSWPDDVPPEGWnR 2005(81); 2012(53); 2013(38); 2013(42); 2015(unpublished);
378 ALQAVYSMMSWPDDVPPEGWnRTR 2012(53); 2014(18); 2015(unpublished);

Sequence

1112131415161718191
MGSNLSPQLCLMPFILGLLSGGVTTTPWSLARPQGSCSLEGVEIKGGSFRLLQEGQALEYVCPSGFYPYPVQTRTCRSTGSWSTLKTQDQKTVRKAECRA
101111121131141151161171181191
IHCPRPHDFENGEYWPRSPYYNVSDEISFHCYDGYTLRGSANRTCQVNGRWSGQTAICDNGAGYCSNPGIPIGTRKVGSQYRLEDSVTYHCSRGLTLRGS
201211221231241251261271281291
QRRTCQEGGSWSGTEPSCQDSFMYDTPQEVAEAFLSSLTETIEGVDAEDGHGPGEQQKRKIVLDPSGSMNIYLVLDGSDSIGASNFTGAKKCLVNLIEKV
301311321331341351361371381391
ASYGVKPRYGLVTYATYPKIWVKVSEADSSNADWVTKQLNEINYEDHKLKSGTNTKKALQAVYSMMSWPDDVPPEGWNRTRHVIILMTDGLHNMGGDPIT
401411421431441451461471481491
VIDEIRDLLYIGKDRKNPREDYLDVYVFGVGPLVNQVNINALASKKDNEQHVFKVKDMENLEDVFYQMIDESQSLSLCGMVWEHRKGTDYHKQPWQAKIS
501511521531541551561571581591
VIRPSKGHESCMGAVVSEYFVLTAAHCFTVDDKEHSIKVSVGGEKRDLEIEVVLFHPNYNINGKKEAGIPEFYDYDVALIKLKNKLKYGQTIRPICLPCT
601611621631641651661671681691
EGTTRALRLPPTTTCQQQKEELLPAQDIKALFVSEEEKKLTRKEVYIKNGDKKGSCERDAQYAPGYDKVKDISEVVTPRFLCTGGVSPYADPNTCRGDSG
701711721731741751761
GPLIVHKRSRFIQVGVISWGVVDVCKNQKRQKQVPAHARDFHINLFQVLPWLKEKLQDEDLGFL

Reference

ID Publication
5Goyallon A, Cholet S, Chapelle M, Junot C, Fenaille F: Evaluation of a combined glycomics and glycoproteomics approach for studying the major glycoproteins present in biofluids: Application to cerebrospinal fluid. Rapid Communications in Mass Spectrometry 2015, 29:461-473.
10Tan ZJ, Yin HD, Nie S, Lin ZX, Zhu JH, Ruffin MT, Anderson MA, Simone DM, Lubman DM: Large-Scale Identification of Core-Fucosylated Glycopeptide Sites in Pancreatic Cancer Serum Using Mass Spectrometry. Journal of Proteome Research 2015, 14:1968-1978.
13Yang W, Laeyendecker O, Wendel SK, Zhang B, Sun S, Zhou J-Y, Ao M, Moore RD, Jackson JB, Zhang H: Glycoproteomic Study Reveals Altered Plasma Proteins Associated with HIV Elite Suppressors. Theranostics 2014, 4:1153.
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
15Chen R, Seebun D, Ye M, Zou H, Figeys D: Site-specific characterization of cell membrane N-glycosylation with integrated hydrophilic interaction chromatography solid phase extraction and LC-MS/MS. Journal of Proteomics 2014, 103:194-203.
18Hirao Y, Matsuzaki H, Iwaki J, Kuno A, Kaji H, Ohkura T, Togayachi A, Abe M, Nomura M, Noguchi M, et al: Glycoproteomics Approach for Identifying Glycobiomarker Candidate Molecules for Tissue Type Classification of Non-small Cell Lung Carcinoma. Journal of Proteome Research 2014, 13:4705-4716.
21Liu L, Yu M, Zhang Y, Wang C, Lu H: Hydrazide Functionalized Core-Shell Magnetic Nanocomposites for Highly Specific Enrichment of N-Glycopeptides. Acs Applied Materials & Interfaces 2014, 6:7823-7832.
22Nicastri A, Gaspari M, Sacco R, Elia L, Gabriele C, Romano R, Rizzuto A, Cuda G: N-Glycoprotein Analysis Discovers New Up-Regulated Glycoproteins in Colorectal Cancer Tissue. Journal of Proteome Research 2014, 13:4932-4941.
26Takakura D, Harazono A, Hashii N, Kawasaki N: Selective glycopeptide profiling by acetone enrichment and LC/MS. Journal of Proteomics 2014, 101:17-30.
28Wang Y, Liu M, Xie L, Fang C, Xiong H, Lu H: Highly Efficient Enrichment Method for Glycopeptide Analyses: Using Specific and Nonspecific Nanoparticles Synergistically. Analytical Chemistry 2014, 86:2057-2064.
31Zhang L, Jiang H, Yao J, Wang Y, Fang C, Yang P, Lu H: Highly specific enrichment of N-linked glycopeptides based on hydrazide functionalized soluble nanopolymers. Chemical Communications 2014, 50:1027-1029.
32Zhang Z, Sun Z, Zhu J, Liu J, Huang G, Ye M, Zou H: High-Throughput Determination of the Site-Specific N-Sialoglycan Occupancy Rates by Differential Oxidation of Glycoproteins Followed with Quantitative Glycoproteomics Analysis. Analytical Chemistry 2014, 86:9830-9837.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
34Sun S, Zhang B, Aiyetan P, Zhou J-Y, Shah P, Yang W, Levine DA, Zhang Z, Chan DW, Zhang H: Analysis of N-glycoproteins using Genomic N-glycosite Prediction. Journal of Proteome Research 2013, 12:5609-5615.
35Chen J, Shah P, Zhang H: Solid phase extraction of N-linked glycopeptides using hydrazide tip. Analytical chemistry 2013, 85:10670-10674.
37Boersema PJ, Geiger T, Wisniewski JR, Mann M: Quantification of the N-glycosylated Secretome by Super-SILAC During Breast Cancer Progression and in Human Blood Samples. Molecular & Cellular Proteomics 2013, 12:158-171.
38Kaji H, Ocho M, Togayachi A, Kuno A, Sogabe M, Ohkura T, Nozaki H, Angata T, Chiba Y, Ozaki H, et al: Glycoproteomic Discovery of Serological Biomarker Candidates for HCV/HBV Infection-Associated Liver Fibrosis and Hepatocellular Carcinoma. Journal of Proteome Research 2013, 12:2630-2640.
40Li X, Jiang J, Zhao X, Wang J, Han H, Zhao Y, Peng B, Zhong R, Ying W, Qian X: N-glycoproteome Analysis of the Secretome of Human Metastatic Hepatocellular Carcinoma Cell Lines Combining Hydrazide Chemistry, HILIC Enrichment and Mass Spectrometry. Plos One 2013, 8.
42Ma C, Zhao X, Han H, Tong W, Zhang Q, Qin P, Chang C, Peng B, Ying W, Qian X: N-linked glycoproteome profiling of human serum using tandem enrichment and multiple fraction concatenation. Electrophoresis 2013, 34:2440-2450.
45Zhou H, Froehlich JW, Briscoe AC, Lee RS: The GlycoFilter: A Simple and Comprehensive Sample Preparation Platform for Proteomics, N-Glycomics and Glycosylation Site Assignment. Molecular & Cellular Proteomics 2013, 12:2981-2991.
48Danzer C, Eckhardt K, Schmidt A, Fankhauser N, Ribrioux S, Wollscheid B, Mueller L, Schiess R, Zuellig R, Lehmann R, et al: Comprehensive Description of the N-Glycoproteome of Mouse Pancreatic beta-Cells and Human Islets. Journal of Proteome Research 2012, 11:1598-1608.
49Kim JY, Kim S-K, Kang D, Moon MH: Dual Lectin-Based Size Sorting Strategy to Enrich Targeted N-Glycopeptides by Asymmetrical Flow Field-Flow Fractionation: Profiling Lung Cancer Biomarkers. Analytical Chemistry 2012, 84:5343-5350.
53Zhu J, Wang F, Chen R, Cheng K, Xu B, Guo Z, Liang X, Ye M, Zou H: Centrifugation Assisted Microreactor Enables Facile Integration of Trypsin Digestion, Hydrophilic Interaction Chromatography Enrichment, and On-Column Deglycosylation for Rapid and Sensitive N-Glycoproteome Analysis. Analytical Chemistry 2012, 84:5146-5153.
54Tian Y, Yao Z, Roden R, Zhang H: Identification of glycoproteins associated with different histological subtypes of ovarian tumors using quantitative glycoproteomics. Proteomics 2011, 11:4677-4687.
60Liu Z, Cao L, He Y, Qiao L, Xu C, Lu H, Yang P: Tandem O-18 Stable Isotope Labeling for Quantification of N-Glycoproteome. Journal of Proteome Research 2010, 9:227-236.
64Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res 2009, 8:651-661.
81Liu T, Qian WJ, Gritsenko MA, Camp DG, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. Journal of Proteome Research 2005, 4:2070-2080.