Contains      

UniProtKB-P01009

Protein Alpha-1-antitrypsin
Gene SERPINA1
Status Reviewed
Source ARO Cell Line (Thyroid Cance); Bladder tumor; Breast Cancer cell lines; Breast cancer xenografts; Breast cell lines; Breast tumor; Cerebrospinal fluid; Colorectal tumor; Colorectal tumors; HCC cell lines (Liver); HCCLM3 cell line (Liver); HEK293 cell line (embryonic kidney); HepG2 cell line (Liver); HuH-7 cell line (Liver); LNCap/PC3 cell lines (Prostate cancer); Liver; Liver tumor (HCC); Lung tumor; Lymphocytes; Non-small Cell Lung Carcinoma; OVCAR-3 cell line (Ovarian cancer); Ovarian tumor; Pancreatic islets; Plasma; Platelet; Platelet Plasma membranes; Prostate; Prostate cancer metastasis to liver; Prostate tumor; Saliva; Serum; Serum (Colorectal cancer); Serum (HCC); Spermatozoa; TPC-1 Cell Line (Thyroid Cance); Urine; lung; ovarian tumor; plasma
Years 2004-20072007

Glycosites

Site Identified Peptides Year(Publication ID)
70 LAHQSnSTN 2009(64);
70 QSnSTNIFF 2014(33);
70 AHQSnSTNIF 2014(33);
70 QLAHQSnSTN 2015(unpublished);2015(unpublished);
70 AHQSnSTNIFF 2012(49); 2014(33);
70 QLAHQSnSTNI 2012(3); 2014(14); 2014(33); 2015(unpublished);
70 QLAHQSnSTNIF 2014(14); 2014(21); 2014(33); 2015(unpublished);
70 RQLAHQSnSTNI 2014(33);
70 QLAHQSnSTNIFF 2014(14); 2014(28); 2014(33); 2015(unpublished);
70 RQLAHQSnSTNIF 2014(33);
70 RQLAHQSnSTNIFF 2014(33);
70 YRQLAHQSnSTNIF 2009(64);
70 QLAHQSnSTNIFFSPV 2014(14); 2014(33); 2015(unpublished);2015(unpublished);
70 QLAHQSnSTNIFFSPVS 2014(14); 2014(33); 2015(unpublished);
70 AFSLYRQLAHQSnSTNIF 2014(33);
70 QLAHQSnSTNIFFSPVSI 2014(14); 2014(33); 2015(unpublished);
70 QSnSTNIFFSPVSIATAF 2014(33);
70 QLAHQSnSTNIFFSPVSIA 2014(14); 2014(33); 2015(unpublished);
70 QLAHQSnSTNIFFSPVSIAT 2014(33);
70 QLAHQSnSTNIFFSPVSIATA 2014(14); 2015(unpublished);
70 QLAHQSnSTNIFFSPVSIATAF 2014(14); 2014(28); 2014(33); 2015(unpublished);2015(5);
70 QLAHQSnSTNIFFSPVSIATAFA 2014(33);
70 RQLAHQSnSTNIFFSPVSIATAF 2014(33);
70 QLAHQSnSTNIFFSPVSIATAFAM 2014(33); 2015(unpublished);
70 QLAHQSnSTNIFFSPVSIATAFAMLSLGTK 2005( 81); 2007(68); 2009(53); 2012(38); 2013(38); 2013(38); 2013(13); 2014(14); 2014(35); 2014(15); 2014(26); 2014(30); 2014(31); 2014(33); 2014(8); 2015(10); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2007(unpublished);2007(UnpublishedUnpublished ); 2007;2007;2007;2007;20072007 ;
70 ITPNLAEFAFSLYRQLAHQSnSTNIFFSPVSIATAFAMLSLGTK 2006(76); 2014(35); 2015(unpublished);
107 GLNFnLTE 2014(33);
107 NFnLTEIPE 2014(33);
107 nLTEIPEAQ 2014(33);
107 GLNFnLTEIPE 2013(42); 2014(33);
107 NFnLTEIPEAQ 2014(33);
107 nLTEIPEAQIH 2014(33);
107 NFnLTEIPEAQIH 2014(33);
107 nLTEIPEAQIHEGF 2012(49); 2014(33);
107 ADTHDEILEGLNFnLT 2014(14); 2015(unpublished);
107 GLNFnLTEIPEAQIHE 2014(33);
107 NFnLTEIPEAQIHEGF 2014(33);
107 nLTEIPEAQIHEGFQEL 2012(49); 2014(33);
107 nLTEIPEAQIHEGFQELL 2014(33);
107 NFnLTEIPEAQIHEGFQEL 2014(33);
107 nLTEIPEAQIHEGFQELLR 2014(19); 2014(33); 2015(unpublished);
107 FnLTEIPEAQIHEGFQELLR 2014(33); 2015(unpublished);
107 ADTHDEILEGLNFnLTEIPEA 2014(14); 2014(33); 2015(unpublished);
107 NFnLTEIPEAQIHEGFQELLR 2010(60); 2014(14); 2014(33); 2015(unpublished);
107 ADTHDEILEGLNFnLTEIPEAQ 2014(14); 2014(28); 2014(33); 2015(unpublished);2015(unpublished);
107 GLNFnLTEIPEAQIHEGFQELLR 2014(33); 2015(unpublished);
107 ADTHDEILEGLNFnLTEIPEAQIH 2013(42); 2014(13); 2014(35); 2014(19); 2014(33); 2015(unpublished);2015(8);
107 EGLNFnLTEIPEAQIHEGFQELLR 2014(28); 2014(33); 2015(unpublished);
107 ADTHDEILEGLNFnLTEIPEAQIHE 2014(33); 2015(unpublished);
107 ADTHDEILEGLNFnLTEIPEAQIHEG 2014(14); 2015(unpublished);2015(unpublished);
107 ADTHDEILEGLNFnLTEIPEAQIHEGF 2014(14); 2014(33); 2015(unpublished);2015(unpublished);
107 ADTHDEILEGLNFnLTEIPEAQIHEGFQ 2015(unpublished);
107 ADTHDEILEGLNFnLTEIPEAQIHEGFQEL 2014(14); 2015(unpublished);2015(unpublished);
107 THDEILEGLNFnLTEIPEAQIHEGFQELLR 2015(unpublished);
107 DTHDEILEGLNFnLTEIPEAQIHEGFQELLR 2015(unpublished);
107 ADTHDEIIEGINFnITEIPEAQIHEGFQEIIR 2014(32); 2014(32);
107 ADTHDEILEGLNFnLTEIPEAQIHEGFQELLR 2005( 81); 2006(76); 2007(62); 2009(63); 2009(64); 2009(66); 2009(51); 2012(53); 2012(34); 2013(38); 2013(38); 2013(38); 2013(38); 2013(42); 2013(45); 2013(13); 2014(35); 2014(15); 2014(26); 2014(31); 2014(33); 2014(2); 2015(5); 2015(8); 2015(10); 2015(11); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2007(unpublished);2007(unpublished);2007(unpublished);2007(UnpublishedUnpublished ); 2007;2007;2007;20072007 ;
107 SLGTKADTHDEILEGLNFnLTEIPEAQIHEGFQEL 2014(33);
271 YLGnATAI 2014(14); 2014(33); 2015(unpublished);
271 LGnATAIFF 2014(33);
271 YLGnATAIF 2014(21); 2014(33);
271 KYLGnATAIF 2014(33);
271 YLGnATAIFF 2014(33);
271 MKYLGnATAIF 2009(64); 2014(33);
271 LMKYLGnATAIF 2009(64); 2014(33);
271 MKYLGnATAIFF 2014(33);
271 IMKYIGnATAIFF 2013(37);
271 nATAIFFLPDEGK 2014(14); 2014(19); 2014(28); 2014(33); 2015(unpublished);
271 GnATAIFFLPDEGK 2014(14); 2014(33); 2015(unpublished);
271 VLLMKYLGnATAIF 2014(33);
271 YLGnATAIFFLPDE 2014(14); 2014(33); 2015(unpublished);
271 LGnATAIFFLPDEGK 2012(48); 2014(14); 2014(33); 2015(unpublished);2015(unpublished);
271 YIGnATAIFFIPDEGK 2014(32); 2014(32);
271 YLGnATAIFFLPDEGK 2004( 82); 2005(79); 2005(80); 2006(76); 2007(71); 2007(74); 2007(69); 2008(62); 2009(62); 2009(63); 2009(64); 2009(66); 2009(59); 2010(60); 2010(40); 2010(54); 2011(56); 2011(48); 2012(49); 2012(51); 2012(52); 2012(53); 2012(34); 2013(38); 2013(38); 2013(38); 2013(38); 2013(39); 2013(40); 2013(42); 2013(45); 2013(13); 2014(14); 2014(35); 2014(15); 2014(18); 2014(19); 2014(21); 2014(22); 2014(23); 2014(26); 2014(28); 2014(30); 2014(31); 2014(33); 2014(1); 2015(5); 2015(7); 2015(8); 2015(10); 2015(11); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(UnpublishedUnpublished ); 2015;2007;2007;2007;2007;2007;2007;20072007 ;
271 KYLGnATAIFFLPDEGK 2014(33); 2015(unpublished);
271 YLGnATAIFFLPDEGKL 2014(33); 2015(unpublished);
271 MKYLGnATAIFFLPDEGK 2014(33);
271 YLGnATAIFFLPDEGKLQ 2014(33);
271 YLGnATAIFFLPDEGKLQH 2014(33);
271 YLGnATAIFFLPDEGKLQHLE 2014(33);
271 YLGnATAIFFLPDEGKLQHLENE 2014(33);
271 LSSWVLLMKYLGnATAIFFLPDEGK 2014(35); 2015(unpublished);
271 KLSSWVLLMKYLGnATAIFFLPDEGK 2006(76); 2015(unpublished);
271 QHCKKLSSWVLLMKYLGnATAIFFLPDEGK 2014(33);
271 YIGnATAIFFIPDEGKIQHIENEITHDIITK 2013(43);
271 YLGnATAIFFLPDEGKLQHLENELTHDIITK 2005(81); 2006(76); 2012(53); 2013(34); 2013(38); 2014(13); 2014(35); 2014(31); 2014(33); 2015(unpublished);2015(2); 2015(unpublished);2015(11);
271 YLGnATAIFFLPDEGKLQHLENELTHDIITKFLENEDR 2015(unpublished);
271 LSSWVLLMKYLGnATAIFFLPDEGKLQHLENELTHDIITK 2015(unpublished);

Sequence

1112131415161718191
MPSSVSWGILLLAGLCCLVPVSLAEDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEI
101111121131141151161171181191
LEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKEL
201211221231241251261271281291
DRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFL
301311321331341351361371381391
ENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIE
401411
QNTKSPLFMGKVVNPTQK

Reference

ID Publication
1Sun S, Shah P, Eshghi ST, Yang W, Trikannad N, Yang S, Chen L, Aiyetan P, Hoti N, Zhang Z, et al: Comprehensive analysis of protein glycosylation by solid-phase extraction of N-linked glycans and glycosite-containing peptides. Nat Biotech 2015, advance online publication.
2Shah P, Wang X, Yang W, Eshghi ST, Sun S, Hoti N, Chen L, Yang S, Pasay J, Rubin A: Integrated Proteomic and Glycoproteomic Analyses of Prostate Cancer Cells Reveal Glycoprotein Alteration in Protein Abundance and Glycosylation. Molecular & Cellular Proteomics 2015, 14:2753-2763.
3Tian Y, Almaraz RT, Choi CH, Li QK, Saeui C, Li D, Shah P, Bhattacharya R, Yarema KJ, Zhang H: Identification of sialylated glycoproteins from metabolically oligosaccharide engineered pancreatic cells. Clinical proteomics 2015, 12:11.
5Goyallon A, Cholet S, Chapelle M, Junot C, Fenaille F: Evaluation of a combined glycomics and glycoproteomics approach for studying the major glycoproteins present in biofluids: Application to cerebrospinal fluid. Rapid Communications in Mass Spectrometry 2015, 29:461-473.
7Li Y, Shah P, De Marzo AM, Van Eyk JE, Lo Q, Chan DW, Zhang H: Identification of Glycoproteins Containing Specific Glycans Using a Lectin-Chemical Method. Analytical Chemistry 2015, 87:4683-4687.
8Ma C, Zhang Q, Qu JY, Zhao XY, Li X, Liu YP, Wang PG: A precise approach in large scale core-fucosylated glycoprotein identification with low- and high-normalized collision energy. Journal of Proteomics 2015, 114:61-70.
10Tan ZJ, Yin HD, Nie S, Lin ZX, Zhu JH, Ruffin MT, Anderson MA, Simone DM, Lubman DM: Large-Scale Identification of Core-Fucosylated Glycopeptide Sites in Pancreatic Cancer Serum Using Mass Spectrometry. Journal of Proteome Research 2015, 14:1968-1978.
11Wang M, Zhang X, Deng C: Facile synthesis of magnetic poly(styrene-co-4-vinylbenzene-boronic acid) microspheres for selective enrichment of glycopeptides. Proteomics 2015, 15:2158-2165.
13Yang W, Laeyendecker O, Wendel SK, Zhang B, Sun S, Zhou J-Y, Ao M, Moore RD, Jackson JB, Zhang H: Glycoproteomic Study Reveals Altered Plasma Proteins Associated with HIV Elite Suppressors. Theranostics 2014, 4:1153.
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
15Chen R, Seebun D, Ye M, Zou H, Figeys D: Site-specific characterization of cell membrane N-glycosylation with integrated hydrophilic interaction chromatography solid phase extraction and LC-MS/MS. Journal of Proteomics 2014, 103:194-203.
18Hirao Y, Matsuzaki H, Iwaki J, Kuno A, Kaji H, Ohkura T, Togayachi A, Abe M, Nomura M, Noguchi M, et al: Glycoproteomics Approach for Identifying Glycobiomarker Candidate Molecules for Tissue Type Classification of Non-small Cell Lung Carcinoma. Journal of Proteome Research 2014, 13:4705-4716.
19Huang G, Sun Z, Qin H, Zhao L, Xiong Z, Peng X, Ou J, Zou H: Preparation of hydrazine functionalized polymer brushes hybrid magnetic nanoparticles for highly specific enrichment of glycopeptides. Analyst 2014, 139:2199-2206.
21Liu L, Yu M, Zhang Y, Wang C, Lu H: Hydrazide Functionalized Core-Shell Magnetic Nanocomposites for Highly Specific Enrichment of N-Glycopeptides. Acs Applied Materials & Interfaces 2014, 6:7823-7832.
22Nicastri A, Gaspari M, Sacco R, Elia L, Gabriele C, Romano R, Rizzuto A, Cuda G: N-Glycoprotein Analysis Discovers New Up-Regulated Glycoproteins in Colorectal Cancer Tissue. Journal of Proteome Research 2014, 13:4932-4941.
23Pan C, Zhou Y, Dator R, Ginghina C, Zhao Y, Movius J, Peskind E, Zabetian CP, Quinn J, Galasko D, et al: Targeted Discovery and Validation of Plasma Biomarkers of Parkinson's Disease. Journal of Proteome Research 2014, 13:4535-4545.
26Takakura D, Harazono A, Hashii N, Kawasaki N: Selective glycopeptide profiling by acetone enrichment and LC/MS. Journal of Proteomics 2014, 101:17-30.
28Wang Y, Liu M, Xie L, Fang C, Xiong H, Lu H: Highly Efficient Enrichment Method for Glycopeptide Analyses: Using Specific and Nonspecific Nanoparticles Synergistically. Analytical Chemistry 2014, 86:2057-2064.
30Xu Y, Bailey U-M, Punyadeera C, Schulz BL: Identification of salivary N-glycoproteins and measurement of glycosylation site occupancy by boronate glycoprotein enrichment and liquid chromatography/electrospray ionization tandem mass spectrometry. Rapid Communications in Mass Spectrometry 2014, 28:471-482.
31Zhang L, Jiang H, Yao J, Wang Y, Fang C, Yang P, Lu H: Highly specific enrichment of N-linked glycopeptides based on hydrazide functionalized soluble nanopolymers. Chemical Communications 2014, 50:1027-1029.
32Zhang Z, Sun Z, Zhu J, Liu J, Huang G, Ye M, Zou H: High-Throughput Determination of the Site-Specific N-Sialoglycan Occupancy Rates by Differential Oxidation of Glycoproteins Followed with Quantitative Glycoproteomics Analysis. Analytical Chemistry 2014, 86:9830-9837.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
34Sun S, Zhang B, Aiyetan P, Zhou J-Y, Shah P, Yang W, Levine DA, Zhang Z, Chan DW, Zhang H: Analysis of N-glycoproteins using Genomic N-glycosite Prediction. Journal of Proteome Research 2013, 12:5609-5615.
35Chen J, Shah P, Zhang H: Solid phase extraction of N-linked glycopeptides using hydrazide tip. Analytical chemistry 2013, 85:10670-10674.
37Boersema PJ, Geiger T, Wisniewski JR, Mann M: Quantification of the N-glycosylated Secretome by Super-SILAC During Breast Cancer Progression and in Human Blood Samples. Molecular & Cellular Proteomics 2013, 12:158-171.
38Kaji H, Ocho M, Togayachi A, Kuno A, Sogabe M, Ohkura T, Nozaki H, Angata T, Chiba Y, Ozaki H, et al: Glycoproteomic Discovery of Serological Biomarker Candidates for HCV/HBV Infection-Associated Liver Fibrosis and Hepatocellular Carcinoma. Journal of Proteome Research 2013, 12:2630-2640.
39Li QK, Shah P, Li Y, Aiyetan PO, Chen J, Yung R, Molena D, Gabrielson E, Askin F, Chan DW, Zhang H: Glycoproteomic Analysis of Bronchoalveolar Lavage (BAL) Fluid Identifies Tumor-Associated Glycoproteins from Lung Adenocarcinonna. Journal of Proteome Research 2013, 12:3689-3696.
40Li X, Jiang J, Zhao X, Wang J, Han H, Zhao Y, Peng B, Zhong R, Ying W, Qian X: N-glycoproteome Analysis of the Secretome of Human Metastatic Hepatocellular Carcinoma Cell Lines Combining Hydrazide Chemistry, HILIC Enrichment and Mass Spectrometry. Plos One 2013, 8.
42Ma C, Zhao X, Han H, Tong W, Zhang Q, Qin P, Chang C, Peng B, Ying W, Qian X: N-linked glycoproteome profiling of human serum using tandem enrichment and multiple fraction concatenation. Electrophoresis 2013, 34:2440-2450.
43Wang GG, Wu YB, Zhou T, Guo YS, Zheng B, Wang J, Bi Y, Liu FJ, Zhou ZM, Guo XJ, Sha JH: Mapping of the N-Linked Glycoproteome of Human Spermatozoa. Journal of Proteome Research 2013, 12:5750-5759.
45Zhou H, Froehlich JW, Briscoe AC, Lee RS: The GlycoFilter: A Simple and Comprehensive Sample Preparation Platform for Proteomics, N-Glycomics and Glycosylation Site Assignment. Molecular & Cellular Proteomics 2013, 12:2981-2991.
48Danzer C, Eckhardt K, Schmidt A, Fankhauser N, Ribrioux S, Wollscheid B, Mueller L, Schiess R, Zuellig R, Lehmann R, et al: Comprehensive Description of the N-Glycoproteome of Mouse Pancreatic beta-Cells and Human Islets. Journal of Proteome Research 2012, 11:1598-1608.
49Kim JY, Kim S-K, Kang D, Moon MH: Dual Lectin-Based Size Sorting Strategy to Enrich Targeted N-Glycopeptides by Asymmetrical Flow Field-Flow Fractionation: Profiling Lung Cancer Biomarkers. Analytical Chemistry 2012, 84:5343-5350.
51Yeh C-H, Chen S-H, Li D-T, Lin H-P, Huang H-J, Chang C-I, Shih W-L, Chern C-L, Shi F-K, Hsu J-L: Magnetic bead-based hydrophilic interaction liquid chromatography for glycopeptide enrichments. Journal of Chromatography A 2012, 1224:70-78.
52Yen T-Y, Macher BA, McDonald CA, Alleyne-Chin C, Timpe LC: Glycoprotein Profiles of Human Breast Cells Demonstrate a Clear Clustering of Normal/Benign versus Malignant Cell Lines and Basal versus Luminal Cell Lines. Journal of Proteome Research 2012, 11:656-667.
53Zhu J, Wang F, Chen R, Cheng K, Xu B, Guo Z, Liang X, Ye M, Zou H: Centrifugation Assisted Microreactor Enables Facile Integration of Trypsin Digestion, Hydrophilic Interaction Chromatography Enrichment, and On-Column Deglycosylation for Rapid and Sensitive N-Glycoproteome Analysis. Analytical Chemistry 2012, 84:5146-5153.
54Tian Y, Yao Z, Roden R, Zhang H: Identification of glycoproteins associated with different histological subtypes of ovarian tumors using quantitative glycoproteomics. Proteomics 2011, 11:4677-4687.
56Bandhakavi S, Van Riper SK, Tawfik PN, Stone MD, Haddad T, Rhodus NL, Carlis JV, Griffin TJ: Hexapeptide Libraries for Enhanced Protein PTM Identification and Relative Abundance Profiling in Whole Human Saliva. Journal of Proteome Research 2011, 10:1052-1061.
59Lee H-J, Na K, Choi E-Y, Kim KS, Kim H, Paik Y-K: Simple Method for Quantitative Analysis of N-Linked Glycoproteins in Hepatocellular Carcinoma Specimens. Journal of Proteome Research 2010, 9:308-318.
60Liu Z, Cao L, He Y, Qiao L, Xu C, Lu H, Yang P: Tandem O-18 Stable Isotope Labeling for Quantification of N-Glycoproteome. Journal of Proteome Research 2010, 9:227-236.
62Arcinas A, Yen T-Y, Kebebew E, Macher BA: Cell Surface and Secreted Protein Profiles of Human Thyroid Cancer Cell Lines Reveal Distinct Glycoprotein Patterns. Journal of Proteome Research 2009, 8:3958-3968.
63Cao J, Shen C, Wang H, Shen H, Chen Y, Nie A, Yan G, Lu H, Liu Y, Yang P: Identification of N-Glycosylation Sites on Secreted Proteins of Human Hepatocellular Carcinoma Cells with a Complementary Proteomics Approach. Journal of Proteome Research 2009, 8:662-672.
64Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res 2009, 8:651-661.
66Jia W, Lu Z, Fu Y, Wang H-P, Wang L-H, Chi H, Yuan Z-F, Zheng Z-B, Song L-N, Han H-H, et al: A Strategy for Precise and Large Scale Identification of Core Fucosylated Glycoproteins. Molecular & Cellular Proteomics 2009, 8:913-923.
68Zhang L, Xu Y, Yao H, Xie L, Yao J, Lu H, Yang P: Boronic Acid Functionalized Core-Satellite Composite Nanoparticles for Advanced Enrichment of Glycopeptides and Glycoproteins. Chemistry-a European Journal 2009, 15:10158-10166.
69Calvano CD, Zambonin CG, Jensen ON: Assessment of lectin and HILIC based enrichment protocols for characterization of serum glycoproteins by mass spectrometry. Journal of Proteomics 2008, 71:304-317.
71Hagglund P, Matthiesen R, Elortza F, Hojrup P, Roepstorff P, Jensen ON, Bunkenborg J: An enzymatic deglycosylation scheme enabling identification of core fucosylated N-glycans and O-glycosylation site mapping of human plasma proteins. Journal of Proteome Research 2007, 6:3021-3031.
74Lewandrowski U, Zahedi RP, Moebius J, Walter U, Sickmann A: Enhanced N-glycosylation site analysis of Sialoglycopeptides by strong cation exchange prefractionation applied to platelet plasma membranes. Molecular & Cellular Proteomics 2007, 6:1933-1941.
76Alvarez-Manilla G, Atwood J, Guo Y, Warren NL, Orlando R, Pierce M: Tools for glycoproteomic analysis: Size exclusion chromatography facilitates identification of tryptic glycopeptides with N-linked glycosylation sites. Journal of Proteome Research 2006, 5:701-708.
79Qiu RQ, Regnier FE: Comparative glycoproteomics of N-linked complex-type glycoforms containing sialic acid in human serum. Analytical Chemistry 2005, 77:7225-7231.
80Qiu RQ, Regnier FE: Use of multidimensional lectin affinity chromatography in differential glycoproteomics. Analytical Chemistry 2005, 77:2802-2809.
81Liu T, Qian WJ, Gritsenko MA, Camp DG, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. Journal of Proteome Research 2005, 4:2070-2080.