Contains      

UniProtKB-P01019

Protein Angiotensinogen
Gene AGT
Status Reviewed
Source Bladder tumor; Breast Cancer cell lines; Breast tumor; Cerebrospinal fluid; HepG2 cell line (Liver); HuH-7 cell line (Liver); Liver; Ovarian tumor; Pancreatic islets; Plasma; Prostate; Prostate tumor; Serum; Serum (Colorectal cancer); Urine; plasma
Years 2005-2015

Glycosites

Site Identified Peptides Year(Publication ID)
47 HLVIHnE 2014(33);
47 nESTCEQLAK 2014(33);
47 IHPFHLVIHnE 2014(33);
47 LVIHnESTCEQ 2009(64);
47 VIHnESTCEQL 2014(33);
47 HLVIHnESTCEQ 2014(33);
47 IHnESTCEQLAK 2014(14); 2015(unpublished);
47 YIHPFHLVIHnE 2014(33);
47 FHIVIHnESTCEQ 2013(37);
47 HLVIHnESTCEQL 2014(33);
47 VIHnESTCEQLAK 2014(14); 2015(unpublished);
47 VYIHPFHLVIHnE 2014(33);
47 HLVIHnESTCEQLA 2014(33);
47 DRVYIHPFHLVIHnE 2014(33);
47 HLVIHnESTCEQLAK 2005(79); 2005(80); 2007(71); 2012(3); 2012(48); 2014(14); 2014(21); 2014(28); 2014(33); 2015(unpublished);
47 HLVIHnESTCEQLAKA 2014(33);
47 HLVIHnESTCEQLAKAN 2014(33);
47 VYIHPFHLVIHnESTCEQLAK 2005( 81); 2007(59); 2010(40); 2010(53); 2012(38); 2013(38); 2013(38); 2013(42); 2013(45); 2013(45); 2013(13); 2014(35); 2014(20); 2014(31); 2014(33); 2014(5); 2015(8); 2015(11); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2007(unpublished);2007;2007;2007;2007;2007;
170 DKnCTSR 2014(14); 2015(unpublished);2015(unpublished);2007(unpublished);2007(unpublished);2007;2007;
170 KDKnCTSRL 2014(33);
170 nCTSRLDAHK 2013(38);
170 VPWKDKnCTSRID 2013(37);
170 LQAILGVPWKDKnCTSR 2013(38); 2013(42); 2014(35); 2014(20); 2015(unpublished);2015(8);
304 WVDnSTSVSVPM 2014(33);
304 VDnSTSVSVPMLSGMGTF 2014(33);
304 GFSLLAEPQEFWVDnSTSV 2007(unpublished);2007(unpublished);2007 (Unpublished );
304 WVDnSTSVSVPMLSGMGTF 2014(33);
328 QHWSDIQDnF 2014(33);
328 QHWSDIQDnFSVT 2014(33);
328 SDIQDnFSVTQVPF 2014(33);
328 QHWSDIQDnFSVTQVPF 2014(33);
328 SDIQDnFSVTQVPFTESACL 2014(33);
328 SDIQDnFSVTQVPFTESACLL 2014(33);
328 QHWSDIQDnFSVTQVPFTESACLL 2014(33);

Sequence

1112131415161718191
MRKRAPQSEMAPAGVSLRATILCLLAWAGLAAGDRVYIHPFHLVIHNESTCEQLAKANAGKPKDPTFIPAPIQAKTSPVDEKALQDQLVLVAAKLDTEDK
101111121131141151161171181191
LRAAMVGMLANFLGFRIYGMHSELWGVVHGATVLSPTAVFGTLASLYLGALDHTADRLQAILGVPWKDKNCTSRLDAHKVLSALQAVQGLLVAQGRADSQ
201211221231241251261271281291
AQLLLSTVVGVFTAPGLHLKQPFVQGLALYTPVVLPRSLDFTELDVAAEKIDRFMQAVTGWKTGCSLMGASVDSTLAFNTYVHFQGKMKGFSLLAEPQEF
301311321331341351361371381391
WVDNSTSVSVPMLSGMGTFQHWSDIQDNFSVTQVPFTESACLLLIQPHYASDLDKVEGLTFQQNSLNWMKKLSPRTIHLTMPQLVLQGSYDLQDLLAQAE
401411421431441451461471481
LPAILHTELNLQKLSNDRIRVGEVLNSIFFELEADEREPTESTQQLNKPEVLEVTLNRPFLFAVYDQSATALHFLGRVANPLSTA

Reference

ID Publication
3Tian Y, Almaraz RT, Choi CH, Li QK, Saeui C, Li D, Shah P, Bhattacharya R, Yarema KJ, Zhang H: Identification of sialylated glycoproteins from metabolically oligosaccharide engineered pancreatic cells. Clinical proteomics 2015, 12:11.
5Goyallon A, Cholet S, Chapelle M, Junot C, Fenaille F: Evaluation of a combined glycomics and glycoproteomics approach for studying the major glycoproteins present in biofluids: Application to cerebrospinal fluid. Rapid Communications in Mass Spectrometry 2015, 29:461-473.
8Ma C, Zhang Q, Qu JY, Zhao XY, Li X, Liu YP, Wang PG: A precise approach in large scale core-fucosylated glycoprotein identification with low- and high-normalized collision energy. Journal of Proteomics 2015, 114:61-70.
11Wang M, Zhang X, Deng C: Facile synthesis of magnetic poly(styrene-co-4-vinylbenzene-boronic acid) microspheres for selective enrichment of glycopeptides. Proteomics 2015, 15:2158-2165.
13Yang W, Laeyendecker O, Wendel SK, Zhang B, Sun S, Zhou J-Y, Ao M, Moore RD, Jackson JB, Zhang H: Glycoproteomic Study Reveals Altered Plasma Proteins Associated with HIV Elite Suppressors. Theranostics 2014, 4:1153.
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
20Kim JY, Oh D, Kim S-K, Kang D, Moon MH: Isotope-Coded Carbamidomethylation for Quantification of N-Glycoproteins with Online Microbore Hollow Fiber Enzyme Reactor-Nanoflow Liquid Chromatography-Tandem Mass Spectrometry. Analytical Chemistry 2014, 86:7650-7657.
21Liu L, Yu M, Zhang Y, Wang C, Lu H: Hydrazide Functionalized Core-Shell Magnetic Nanocomposites for Highly Specific Enrichment of N-Glycopeptides. Acs Applied Materials & Interfaces 2014, 6:7823-7832.
28Wang Y, Liu M, Xie L, Fang C, Xiong H, Lu H: Highly Efficient Enrichment Method for Glycopeptide Analyses: Using Specific and Nonspecific Nanoparticles Synergistically. Analytical Chemistry 2014, 86:2057-2064.
31Zhang L, Jiang H, Yao J, Wang Y, Fang C, Yang P, Lu H: Highly specific enrichment of N-linked glycopeptides based on hydrazide functionalized soluble nanopolymers. Chemical Communications 2014, 50:1027-1029.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
35Chen J, Shah P, Zhang H: Solid phase extraction of N-linked glycopeptides using hydrazide tip. Analytical chemistry 2013, 85:10670-10674.
37Boersema PJ, Geiger T, Wisniewski JR, Mann M: Quantification of the N-glycosylated Secretome by Super-SILAC During Breast Cancer Progression and in Human Blood Samples. Molecular & Cellular Proteomics 2013, 12:158-171.
38Kaji H, Ocho M, Togayachi A, Kuno A, Sogabe M, Ohkura T, Nozaki H, Angata T, Chiba Y, Ozaki H, et al: Glycoproteomic Discovery of Serological Biomarker Candidates for HCV/HBV Infection-Associated Liver Fibrosis and Hepatocellular Carcinoma. Journal of Proteome Research 2013, 12:2630-2640.
40Li X, Jiang J, Zhao X, Wang J, Han H, Zhao Y, Peng B, Zhong R, Ying W, Qian X: N-glycoproteome Analysis of the Secretome of Human Metastatic Hepatocellular Carcinoma Cell Lines Combining Hydrazide Chemistry, HILIC Enrichment and Mass Spectrometry. Plos One 2013, 8.
42Ma C, Zhao X, Han H, Tong W, Zhang Q, Qin P, Chang C, Peng B, Ying W, Qian X: N-linked glycoproteome profiling of human serum using tandem enrichment and multiple fraction concatenation. Electrophoresis 2013, 34:2440-2450.
45Zhou H, Froehlich JW, Briscoe AC, Lee RS: The GlycoFilter: A Simple and Comprehensive Sample Preparation Platform for Proteomics, N-Glycomics and Glycosylation Site Assignment. Molecular & Cellular Proteomics 2013, 12:2981-2991.
48Danzer C, Eckhardt K, Schmidt A, Fankhauser N, Ribrioux S, Wollscheid B, Mueller L, Schiess R, Zuellig R, Lehmann R, et al: Comprehensive Description of the N-Glycoproteome of Mouse Pancreatic beta-Cells and Human Islets. Journal of Proteome Research 2012, 11:1598-1608.
53Zhu J, Wang F, Chen R, Cheng K, Xu B, Guo Z, Liang X, Ye M, Zou H: Centrifugation Assisted Microreactor Enables Facile Integration of Trypsin Digestion, Hydrophilic Interaction Chromatography Enrichment, and On-Column Deglycosylation for Rapid and Sensitive N-Glycoproteome Analysis. Analytical Chemistry 2012, 84:5146-5153.
59Lee H-J, Na K, Choi E-Y, Kim KS, Kim H, Paik Y-K: Simple Method for Quantitative Analysis of N-Linked Glycoproteins in Hepatocellular Carcinoma Specimens. Journal of Proteome Research 2010, 9:308-318.
64Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res 2009, 8:651-661.
71Hagglund P, Matthiesen R, Elortza F, Hojrup P, Roepstorff P, Jensen ON, Bunkenborg J: An enzymatic deglycosylation scheme enabling identification of core fucosylated N-glycans and O-glycosylation site mapping of human plasma proteins. Journal of Proteome Research 2007, 6:3021-3031.
79Qiu RQ, Regnier FE: Comparative glycoproteomics of N-linked complex-type glycoforms containing sialic acid in human serum. Analytical Chemistry 2005, 77:7225-7231.
80Qiu RQ, Regnier FE: Use of multidimensional lectin affinity chromatography in differential glycoproteomics. Analytical Chemistry 2005, 77:2802-2809.