Contains      

UniProtKB-P02679

Protein Fibrinogen gamma chain
Gene FGG
Status Reviewed
Source Bladder tumor; Breast tumor; Cerebrospinal fluid; Colorectal tumor; Colorectal tumors; HCC cell lines (Liver); HepG2 cell line (Liver); HuH-7 cell line (Liver); Liver; Liver tumor (HCC); Ovarian tumor; Pancreatic islets; Plasma; Platelet; Prostate; Prostate cancer metastasis to liver; Prostate tumor; Saliva; Serum; Urine; milk; plasma
Years 2005-20072007

Glycosites

Site Identified Peptides Year(Publication ID)
78 LHQVEnK 2014(33);
78 ILHQVEnK 2015(unpublished);
78 DILHQVEnK 2014(19); 2014(33);
78 EDILHQVEnK 2014(33); 2015(unpublished);
78 HQVEnKTSEVK 2014(33);
78 ILHQVEnKTSE 2009(64);
78 VEnKTSEVKQL 2009(64);
78 DILHQVEnKTSE 2013(42); 2014(33);
78 HQVEnKTSEVKQ 2014(33);
78 QVEnKTSEVKQL 2014(33);
78 SLEDILHQVEnK 2007(71); 2014(27); 2015(unpublished);
78 HQVEnKTSEVKQL 2014(33);
78 DILHQVEnKTSEVK 2014(33);
78 LQSLEDILHQVEnK 2014(33);
78 DLQSLEDILHQVEnK 2005( 81); 2007(71); 2007(64); 2009(66); 2009(56); 2011(34); 2013(38); 2013(38); 2013(40); 2013(42); 2013(45); 2013(13); 2014(14); 2014(22); 2014(27); 2014(33); 2014(5); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2007(UnpublishedUnpublished ); 2007;2007;2007;2007;2007;20072007 ;
78 DLQSLEDILHQVEnKT 2013(38);
78 DKDLQSLEDILHQVEnK 2015(unpublished);
78 EDILHQVEnKTSEVKQL 2014(33);
78 DLQSLEDILHQVEnKTSE 2014(33);
78 VDKDIQSIEDIIHQVEnK 2014(32);
78 VDKDLQSLEDILHQVEnK 2007(71); 2008(70); 2009(64); 2009(66); 2009(68); 2010(40); 2012(48); 2013(34); 2013(42); 2013(45); 2013(45); 2014(13); 2014(14); 2014(35); 2014(19); 2014(22); 2014(27); 2014(33); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);
78 VDKDLQSLEDILHQVEnKT 2014(14); 2015(unpublished);
78 DLQSLEDILHQVEnKTSEVK 2010(59); 2013(42); 2014(33); 2015(unpublished);
78 VDKDLQSLEDILHQVEnKTSE 2014(33);
78 VDKDLQSLEDILHQVEnKTSEVK 2010(59); 2013(34); 2013(38); 2013(38); 2013(42); 2014(13); 2014(33); 2015(unpublished);

Sequence

1112131415161718191
MSWSLHPRNLILYFYALLFLSSTCVAYVATRDNCCILDERFGSYCPTTCGIADFLSTYQTKVDKDLQSLEDILHQVENKTSEVKQLIKAIQLTYNPDESS
101111121131141151161171181191
KPNMIDAATLKSRKMLEEIMKYEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKA
201211221231241251261271281291
NQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKY
301311321331341351361371381391
RLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKT
401411421431441451
RWYSMKKTTMKIIPFNRLTIGEGQQHHLGGAKQVRPEHPAETEYDSLYPEDDL

Reference

ID Publication
5Goyallon A, Cholet S, Chapelle M, Junot C, Fenaille F: Evaluation of a combined glycomics and glycoproteomics approach for studying the major glycoproteins present in biofluids: Application to cerebrospinal fluid. Rapid Communications in Mass Spectrometry 2015, 29:461-473.
13Yang W, Laeyendecker O, Wendel SK, Zhang B, Sun S, Zhou J-Y, Ao M, Moore RD, Jackson JB, Zhang H: Glycoproteomic Study Reveals Altered Plasma Proteins Associated with HIV Elite Suppressors. Theranostics 2014, 4:1153.
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
19Huang G, Sun Z, Qin H, Zhao L, Xiong Z, Peng X, Ou J, Zou H: Preparation of hydrazine functionalized polymer brushes hybrid magnetic nanoparticles for highly specific enrichment of glycopeptides. Analyst 2014, 139:2199-2206.
22Nicastri A, Gaspari M, Sacco R, Elia L, Gabriele C, Romano R, Rizzuto A, Cuda G: N-Glycoprotein Analysis Discovers New Up-Regulated Glycoproteins in Colorectal Cancer Tissue. Journal of Proteome Research 2014, 13:4932-4941.
27Wang J, Zhou C, Zhang W, Yao J, Lu HJ, Dong QZ, Zhou HJ, Qin LX: An integrative strategy for quantitative analysis of the N-glycoproteome in complex biological samples. Proteome Science 2014, 12.
32Zhang Z, Sun Z, Zhu J, Liu J, Huang G, Ye M, Zou H: High-Throughput Determination of the Site-Specific N-Sialoglycan Occupancy Rates by Differential Oxidation of Glycoproteins Followed with Quantitative Glycoproteomics Analysis. Analytical Chemistry 2014, 86:9830-9837.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
34Sun S, Zhang B, Aiyetan P, Zhou J-Y, Shah P, Yang W, Levine DA, Zhang Z, Chan DW, Zhang H: Analysis of N-glycoproteins using Genomic N-glycosite Prediction. Journal of Proteome Research 2013, 12:5609-5615.
35Chen J, Shah P, Zhang H: Solid phase extraction of N-linked glycopeptides using hydrazide tip. Analytical chemistry 2013, 85:10670-10674.
38Kaji H, Ocho M, Togayachi A, Kuno A, Sogabe M, Ohkura T, Nozaki H, Angata T, Chiba Y, Ozaki H, et al: Glycoproteomic Discovery of Serological Biomarker Candidates for HCV/HBV Infection-Associated Liver Fibrosis and Hepatocellular Carcinoma. Journal of Proteome Research 2013, 12:2630-2640.
40Li X, Jiang J, Zhao X, Wang J, Han H, Zhao Y, Peng B, Zhong R, Ying W, Qian X: N-glycoproteome Analysis of the Secretome of Human Metastatic Hepatocellular Carcinoma Cell Lines Combining Hydrazide Chemistry, HILIC Enrichment and Mass Spectrometry. Plos One 2013, 8.
42Ma C, Zhao X, Han H, Tong W, Zhang Q, Qin P, Chang C, Peng B, Ying W, Qian X: N-linked glycoproteome profiling of human serum using tandem enrichment and multiple fraction concatenation. Electrophoresis 2013, 34:2440-2450.
45Zhou H, Froehlich JW, Briscoe AC, Lee RS: The GlycoFilter: A Simple and Comprehensive Sample Preparation Platform for Proteomics, N-Glycomics and Glycosylation Site Assignment. Molecular & Cellular Proteomics 2013, 12:2981-2991.
48Danzer C, Eckhardt K, Schmidt A, Fankhauser N, Ribrioux S, Wollscheid B, Mueller L, Schiess R, Zuellig R, Lehmann R, et al: Comprehensive Description of the N-Glycoproteome of Mouse Pancreatic beta-Cells and Human Islets. Journal of Proteome Research 2012, 11:1598-1608.
56Bandhakavi S, Van Riper SK, Tawfik PN, Stone MD, Haddad T, Rhodus NL, Carlis JV, Griffin TJ: Hexapeptide Libraries for Enhanced Protein PTM Identification and Relative Abundance Profiling in Whole Human Saliva. Journal of Proteome Research 2011, 10:1052-1061.
59Lee H-J, Na K, Choi E-Y, Kim KS, Kim H, Paik Y-K: Simple Method for Quantitative Analysis of N-Linked Glycoproteins in Hepatocellular Carcinoma Specimens. Journal of Proteome Research 2010, 9:308-318.
64Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res 2009, 8:651-661.
66Jia W, Lu Z, Fu Y, Wang H-P, Wang L-H, Chi H, Yuan Z-F, Zheng Z-B, Song L-N, Han H-H, et al: A Strategy for Precise and Large Scale Identification of Core Fucosylated Glycoproteins. Molecular & Cellular Proteomics 2009, 8:913-923.
68Zhang L, Xu Y, Yao H, Xie L, Yao J, Lu H, Yang P: Boronic Acid Functionalized Core-Satellite Composite Nanoparticles for Advanced Enrichment of Glycopeptides and Glycoproteins. Chemistry-a European Journal 2009, 15:10158-10166.
70Picariello G, Ferranti P, Mamone G, Roepstorff P, Addeo F: Identification of N-linked glycoproteins in human milk by hydrophilic interaction liquid chromatography and mass spectrometry. Proteomics 2008, 8:3833-3847.
71Hagglund P, Matthiesen R, Elortza F, Hojrup P, Roepstorff P, Jensen ON, Bunkenborg J: An enzymatic deglycosylation scheme enabling identification of core fucosylated N-glycans and O-glycosylation site mapping of human plasma proteins. Journal of Proteome Research 2007, 6:3021-3031.