Contains      

UniProtKB-P02743

Protein Serum amyloid P-component
Gene APCS
Status Reviewed
Source Bladder tumor; Breast tumor; Liver; Ovarian tumor; Plasma; Platelet; Prostate tumor; Serum; Serum (HCC); Spermatozoa; Urine; plasma
Years 2004-2015

Glycosites

Site Identified Peptides Year(Publication ID)
51 KPLQnF 2014(33);
51 EKPLQnF 2014(33);
51 nFTLCFR 2014(33);
51 QnFTLCFR 2014(33);
51 PIQnFTICFR 2013(43);
51 PLQnFTLCFR 2004(82); 2013(42); 2014(33); 2015(unpublished);
51 EKPLQnFTLCF 2014(33);
51 ITPLEKPLQnF 2014(33);
51 KPLQnFTLCFR 2014(33);
51 EKPLQnFTLCFR 2004(82); 2007(71); 2014(33); 2015(unpublished);
51 LITPLEKPLQnF 2014(33);
51 HVNLITPLEKPLQnF 2014(33);
51 ITPLEKPLQnFTLCF 2014(33);
51 ITPLEKPLQnFTLCFR 2014(33);
51 LITPLEKPLQnFTLCFR 2004(82); 2014(33); 2015(unpublished);
51 NLITPLEKPLQnFTLCFR 2014(33);
51 ESVTDHVNLITPLEKPLQnF 2014(33); 2015(unpublished);
51 ESVTDHVNLITPLEKPLQnFTL 2014(33); 2015(unpublished);
51 ESVTDHVNLITPLEKPLQnFTLC 2004(82); 2014(33); 2015(unpublished);
51 VFPRESVTDHVNLITPLEKPLQnF 2014(33);
51 ESVTDHVNLITPLEKPLQnFTLCFR 2004( 82); 2005(81); 2007(64); 2009(40); 2010(53); 2012(34); 2013(38); 2013(38); 2013(42); 2013(13); 2014(20); 2014(24); 2014(33); 2014(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2007(Unpublished ); 2007;2007;2007;2007 ;
51 VFPRESVTDHVNLITPLEKPLQnFTLCF 2014(33);
129 FWInGTPLVK 2014(33);

Sequence

1112131415161718191
MNKPLLWISVLTSLLEAFAHTDLSGKVFVFPRESVTDHVNLITPLEKPLQNFTLCFRAYSDLSRAYSLFSYNTQGRDNELLVYKERVGEYSLYIGRHKVT
101111121131141151161171181191
SKVIEKFPAPVHICVSWESSSGIAEFWINGTPLVKKGLRQGYFVEAQPKIVLGQEQDSYGGKFDRSQSFVGEIGDLYMWDSVLPPENILSAYQGTPLPAN
201211221
ILDWQALNYEIRGYVIIKPLVWV

Reference

ID Publication
13Yang W, Laeyendecker O, Wendel SK, Zhang B, Sun S, Zhou J-Y, Ao M, Moore RD, Jackson JB, Zhang H: Glycoproteomic Study Reveals Altered Plasma Proteins Associated with HIV Elite Suppressors. Theranostics 2014, 4:1153.
20Kim JY, Oh D, Kim S-K, Kang D, Moon MH: Isotope-Coded Carbamidomethylation for Quantification of N-Glycoproteins with Online Microbore Hollow Fiber Enzyme Reactor-Nanoflow Liquid Chromatography-Tandem Mass Spectrometry. Analytical Chemistry 2014, 86:7650-7657.
24Song E, Zhu R, Hammond ZT, Mechref Y: LC-MS/MS Quantitation of Esophagus Disease Blood Serum Glycoproteins by Enrichment with Hydrazide Chemistry and Lectin Affinity Chromatography. Journal of Proteome Research 2014, 13:4808-4820.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
34Sun S, Zhang B, Aiyetan P, Zhou J-Y, Shah P, Yang W, Levine DA, Zhang Z, Chan DW, Zhang H: Analysis of N-glycoproteins using Genomic N-glycosite Prediction. Journal of Proteome Research 2013, 12:5609-5615.
38Kaji H, Ocho M, Togayachi A, Kuno A, Sogabe M, Ohkura T, Nozaki H, Angata T, Chiba Y, Ozaki H, et al: Glycoproteomic Discovery of Serological Biomarker Candidates for HCV/HBV Infection-Associated Liver Fibrosis and Hepatocellular Carcinoma. Journal of Proteome Research 2013, 12:2630-2640.
40Li X, Jiang J, Zhao X, Wang J, Han H, Zhao Y, Peng B, Zhong R, Ying W, Qian X: N-glycoproteome Analysis of the Secretome of Human Metastatic Hepatocellular Carcinoma Cell Lines Combining Hydrazide Chemistry, HILIC Enrichment and Mass Spectrometry. Plos One 2013, 8.
42Ma C, Zhao X, Han H, Tong W, Zhang Q, Qin P, Chang C, Peng B, Ying W, Qian X: N-linked glycoproteome profiling of human serum using tandem enrichment and multiple fraction concatenation. Electrophoresis 2013, 34:2440-2450.
43Wang GG, Wu YB, Zhou T, Guo YS, Zheng B, Wang J, Bi Y, Liu FJ, Zhou ZM, Guo XJ, Sha JH: Mapping of the N-Linked Glycoproteome of Human Spermatozoa. Journal of Proteome Research 2013, 12:5750-5759.
53Zhu J, Wang F, Chen R, Cheng K, Xu B, Guo Z, Liang X, Ye M, Zou H: Centrifugation Assisted Microreactor Enables Facile Integration of Trypsin Digestion, Hydrophilic Interaction Chromatography Enrichment, and On-Column Deglycosylation for Rapid and Sensitive N-Glycoproteome Analysis. Analytical Chemistry 2012, 84:5146-5153.
64Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res 2009, 8:651-661.
71Hagglund P, Matthiesen R, Elortza F, Hojrup P, Roepstorff P, Jensen ON, Bunkenborg J: An enzymatic deglycosylation scheme enabling identification of core fucosylated N-glycans and O-glycosylation site mapping of human plasma proteins. Journal of Proteome Research 2007, 6:3021-3031.
81Liu T, Qian WJ, Gritsenko MA, Camp DG, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. Journal of Proteome Research 2005, 4:2070-2080.
82Hagglund P, Bunkenborg J, Elortza F, Jensen ON, Roepstorff P: A new strategy for identification of N-glycosylated proteins and unambiguous assignment of their glycosylation sites using HILIC enrichment and partial deglycosylation. Journal of Proteome Research 2004, 3:556-566.