Contains      

UniProtKB-P02745

Protein Complement C1q subcomponent subunit A
Gene C1QA
Status Reviewed
Source Bladder tumor; Breast tumor; Cerebrospinal fluid; Colorectal tumor; HuH-7 cell line (Liver); Liver; Liver tumor (HCC); Non-small Cell Lung Carcinoma; Ovarian tumor; Pancreatic islets; Plasma; Platelet; Prostate; Prostate tumor; Saliva; Serum; Serum (HCC); Urine; plasma
Years 2005-2015

Glycosites

Site Identified Peptides Year(Publication ID)
146 EEPYQnHSGR 2015(unpublished);
146 EEPYQnHSGRF 2011(56);
146 QEEPYQnHSGR 2014(27); 2014(33); 2015(unpublished);
146 NQEEPYQnHSGR 2015(unpublished);
146 DTVITNQEEPYQnH 2014(33);
146 ITNQEEPYQnHSGRF 2009(64);
146 VITNQEEPYQnHSGR 2014(14); 2014(33); 2015(unpublished);
146 TVITNQEEPYQnHSGR 2014(27); 2014(33);
146 VITNQEEPYQnHSGRF 2009(64);
146 DTVITNQEEPYQnHSGR 2007(71); 2014(27); 2014(33); 2015(unpublished);
146 DTVITNQEEPYQnHSGRF 2014(33);
146 IFDTVITNQEEPYQnHSGR 2014(33); 2015(unpublished);
146 IFDTVITNQEEPYQnHSGRF 2014(33);
146 VVIFDTVITNQEEPYQnHSGR 2014(27); 2014(33); 2015(unpublished);
146 PMGGNVVIFDTVITNQEEPYQnHSGR 2015(unpublished);
146 PPMGGNVVIFDTVITNQEEPYQnHSGR 2015(unpublished);
146 NPPMGGNVVIFDTVITNQEEPYQnHSGR 2005( 81); 2007(71); 2007(73); 2007(64); 2009(60); 2010(40); 2010(48); 2012(53); 2012(34); 2013(38); 2013(38); 2013(42); 2013(45); 2013(13); 2014(14); 2014(35); 2014(18); 2014(22); 2014(31); 2014(33); 2014(5); 2015(8); 2015(10); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2007(unpublished);2007(Unpublished ); 2007;2007;2007;2007;2007 ;
146 RNPPMGGNVVIFDTVITNQEEPYQnHSGR 2009(64); 2010(40); 2012(53); 2013(34); 2013(38); 2013(38); 2013(38); 2013(42); 2013(45); 2014(13); 2014(35); 2014(31); 2014(32); 2014(33); 2015(unpublished);2015(unpublished);2015(unpublished);2015(8); 2015(11);
146 RNPPMGGNVVIFDTVITNQEEPYQnHSGRF 2014(33);

Sequence

1112131415161718191
MEGPRGWLVLCVLAISLASMVTEDLCRAPDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIRTGIQGLKGDQGEPGPSGNPGKVGYPGPSGPLGARGIPGIK
101111121131141151161171181191
GTKGSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQV
201211221231241
VSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFSGFLIFPSA

Reference

ID Publication
5Goyallon A, Cholet S, Chapelle M, Junot C, Fenaille F: Evaluation of a combined glycomics and glycoproteomics approach for studying the major glycoproteins present in biofluids: Application to cerebrospinal fluid. Rapid Communications in Mass Spectrometry 2015, 29:461-473.
8Ma C, Zhang Q, Qu JY, Zhao XY, Li X, Liu YP, Wang PG: A precise approach in large scale core-fucosylated glycoprotein identification with low- and high-normalized collision energy. Journal of Proteomics 2015, 114:61-70.
10Tan ZJ, Yin HD, Nie S, Lin ZX, Zhu JH, Ruffin MT, Anderson MA, Simone DM, Lubman DM: Large-Scale Identification of Core-Fucosylated Glycopeptide Sites in Pancreatic Cancer Serum Using Mass Spectrometry. Journal of Proteome Research 2015, 14:1968-1978.
11Wang M, Zhang X, Deng C: Facile synthesis of magnetic poly(styrene-co-4-vinylbenzene-boronic acid) microspheres for selective enrichment of glycopeptides. Proteomics 2015, 15:2158-2165.
13Yang W, Laeyendecker O, Wendel SK, Zhang B, Sun S, Zhou J-Y, Ao M, Moore RD, Jackson JB, Zhang H: Glycoproteomic Study Reveals Altered Plasma Proteins Associated with HIV Elite Suppressors. Theranostics 2014, 4:1153.
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
18Hirao Y, Matsuzaki H, Iwaki J, Kuno A, Kaji H, Ohkura T, Togayachi A, Abe M, Nomura M, Noguchi M, et al: Glycoproteomics Approach for Identifying Glycobiomarker Candidate Molecules for Tissue Type Classification of Non-small Cell Lung Carcinoma. Journal of Proteome Research 2014, 13:4705-4716.
22Nicastri A, Gaspari M, Sacco R, Elia L, Gabriele C, Romano R, Rizzuto A, Cuda G: N-Glycoprotein Analysis Discovers New Up-Regulated Glycoproteins in Colorectal Cancer Tissue. Journal of Proteome Research 2014, 13:4932-4941.
27Wang J, Zhou C, Zhang W, Yao J, Lu HJ, Dong QZ, Zhou HJ, Qin LX: An integrative strategy for quantitative analysis of the N-glycoproteome in complex biological samples. Proteome Science 2014, 12.
31Zhang L, Jiang H, Yao J, Wang Y, Fang C, Yang P, Lu H: Highly specific enrichment of N-linked glycopeptides based on hydrazide functionalized soluble nanopolymers. Chemical Communications 2014, 50:1027-1029.
32Zhang Z, Sun Z, Zhu J, Liu J, Huang G, Ye M, Zou H: High-Throughput Determination of the Site-Specific N-Sialoglycan Occupancy Rates by Differential Oxidation of Glycoproteins Followed with Quantitative Glycoproteomics Analysis. Analytical Chemistry 2014, 86:9830-9837.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
34Sun S, Zhang B, Aiyetan P, Zhou J-Y, Shah P, Yang W, Levine DA, Zhang Z, Chan DW, Zhang H: Analysis of N-glycoproteins using Genomic N-glycosite Prediction. Journal of Proteome Research 2013, 12:5609-5615.
35Chen J, Shah P, Zhang H: Solid phase extraction of N-linked glycopeptides using hydrazide tip. Analytical chemistry 2013, 85:10670-10674.
38Kaji H, Ocho M, Togayachi A, Kuno A, Sogabe M, Ohkura T, Nozaki H, Angata T, Chiba Y, Ozaki H, et al: Glycoproteomic Discovery of Serological Biomarker Candidates for HCV/HBV Infection-Associated Liver Fibrosis and Hepatocellular Carcinoma. Journal of Proteome Research 2013, 12:2630-2640.
40Li X, Jiang J, Zhao X, Wang J, Han H, Zhao Y, Peng B, Zhong R, Ying W, Qian X: N-glycoproteome Analysis of the Secretome of Human Metastatic Hepatocellular Carcinoma Cell Lines Combining Hydrazide Chemistry, HILIC Enrichment and Mass Spectrometry. Plos One 2013, 8.
42Ma C, Zhao X, Han H, Tong W, Zhang Q, Qin P, Chang C, Peng B, Ying W, Qian X: N-linked glycoproteome profiling of human serum using tandem enrichment and multiple fraction concatenation. Electrophoresis 2013, 34:2440-2450.
45Zhou H, Froehlich JW, Briscoe AC, Lee RS: The GlycoFilter: A Simple and Comprehensive Sample Preparation Platform for Proteomics, N-Glycomics and Glycosylation Site Assignment. Molecular & Cellular Proteomics 2013, 12:2981-2991.
48Danzer C, Eckhardt K, Schmidt A, Fankhauser N, Ribrioux S, Wollscheid B, Mueller L, Schiess R, Zuellig R, Lehmann R, et al: Comprehensive Description of the N-Glycoproteome of Mouse Pancreatic beta-Cells and Human Islets. Journal of Proteome Research 2012, 11:1598-1608.
53Zhu J, Wang F, Chen R, Cheng K, Xu B, Guo Z, Liang X, Ye M, Zou H: Centrifugation Assisted Microreactor Enables Facile Integration of Trypsin Digestion, Hydrophilic Interaction Chromatography Enrichment, and On-Column Deglycosylation for Rapid and Sensitive N-Glycoproteome Analysis. Analytical Chemistry 2012, 84:5146-5153.
56Bandhakavi S, Van Riper SK, Tawfik PN, Stone MD, Haddad T, Rhodus NL, Carlis JV, Griffin TJ: Hexapeptide Libraries for Enhanced Protein PTM Identification and Relative Abundance Profiling in Whole Human Saliva. Journal of Proteome Research 2011, 10:1052-1061.
60Liu Z, Cao L, He Y, Qiao L, Xu C, Lu H, Yang P: Tandem O-18 Stable Isotope Labeling for Quantification of N-Glycoproteome. Journal of Proteome Research 2010, 9:227-236.
64Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res 2009, 8:651-661.
71Hagglund P, Matthiesen R, Elortza F, Hojrup P, Roepstorff P, Jensen ON, Bunkenborg J: An enzymatic deglycosylation scheme enabling identification of core fucosylated N-glycans and O-glycosylation site mapping of human plasma proteins. Journal of Proteome Research 2007, 6:3021-3031.
73Larsen MR, Jensen SS, Jakobsen LA, Heegaard NHH: Exploring the sialiome using titanium dioxide chromatography and mass spectrometry. Molecular & Cellular Proteomics 2007, 6:1778-1787.