Contains      

UniProtKB-P02748

Protein Complement component C9
Gene C9
Status Reviewed
Source Breast tumor; Cerebrospinal fluid; HEK293 cell line (embryonic kidney); Liver; Lung Adenocarcinoma; Lung tumor; Ovarian tumor; Plasma; Platelet; Prostate; Prostate tumor; Saliva; Serum; Serum (HCC); Urine; lung; plasma
Years 2005-2015

Glycosites

Site Identified Peptides Year(Publication ID)
277 nETYQLF 2014(33);
277 SKnETYQL 2014(33);
277 SYSKnETY 2014(33);
277 FSYSKnETY 2014(33);
277 SKnETYQLF 2014(33);
277 SYSKnETYQ 2014(33);
277 FSYSKnETYQ 2009(64); 2012(3); 2015(unpublished);
277 SKnETYQLFL 2014(33);
277 SYSKnETYQL 2014(33);
277 FSYSKnETYQL 2007(unpublished);2014(33);
277 SYSKnETYQLF 2014(33);
277 FSYSKnETYQLF 2014(33);
277 RFSYSKnETYQL 2009(64);
277 SYSKnETYQLFL 2014(33);
277 nETYQLFLSYSSK 2005( 81); 2013(42); 2015(unpublished);2015(unpublished);2007(unpublished);2007(unpublished);2007;2007;
277 FSYSKnETYQLFLSY 2014(33);
277 FSYSKnETYQLFLSYSSK 2013(38); 2014(13); 2014(35); 2014(33); 2015(unpublished);2015(unpublished);2015(unpublished);2015(10);
277 FSYSKnETYQLFLSYSSKK 2014(33); 2015(unpublished);
415 AVnITSE 2014(33);
415 AVnITSENL 2014(33);
415 AVnITSENLID 2014(33);
415 AVnITSENLIDD 2014(33);
415 AVnITSENLIDDVV 2014(14); 2015(unpublished);
415 GRAVnITSENLIDD 2013(42);
415 AVnITSENLIDDVVS 2014(33);
415 AVnITSENLIDDVVSL 2012(49);
415 AVnITSENLIDDVVSLIR 2005( 79); 2005(80); 2005(81); 2007(71); 2007(69); 2008(64); 2009(66); 2009(59); 2010(60); 2010(56); 2011(53); 2012(38); 2013(38); 2013(39); 2013(42); 2013(45); 2013(13); 2014(14); 2014(35); 2014(36); 2014(15); 2014(27); 2014(31); 2014(33); 2014(5); 2015(8); 2015(10); 2015(11); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015;2015;2007;2007;2007;2007;2007;

Sequence

1112131415161718191
MSACRSFAVAICILEISILTAQYTTSYDPELTESSGSASHIDCRMSPWSEWSQCDPCLRQMFRSRSIEVFGQFNGKRCTDAVGDRRQCVPTEPCEDAEDD
101111121131141151161171181191
CGNDFQCSTGRCIKMRLRCNGDNDCGDFSDEDDCESEPRPPCRDRVVEESELARTAGYGINILGMDPLSTPFDNEFYNGLCNRDRDGNTLTYYRRPWNVA
201211221231241251261271281291
SLIYETKGEKNFRTEHYEEQIEAFKSIIQEKTSNFNAAISLKFTPTETNKAEQCCEETASSISLHGKGSFRFSYSKNETYQLFLSYSSKKEKMFLHVKGE
301311321331341351361371381391
IHLGRFVMRNRDVVLTTTFVDDIKALPTTYEKGEYFAFLETYGTHYSSSGSLGGLYELIYVLDKASMKRKGVELKDIKRCLGYHLDVSLAFSEISVGAEF
401411421431441451461471481491
NKDDCVKRGEGRAVNITSENLIDDVVSLIRGGTRKYAFELKEKLLRGTVIDVTDFVNWASSINDAPVLISQKLSPIYNLVPVKMKNAHLKKQNLERAIED
501511521531541551
YINEFSVRKCHTCQNGGTVILMDGKCLCACPFKFEGIACEISKQKISEGLPALEFPNEK

Reference

ID Publication
3Tian Y, Almaraz RT, Choi CH, Li QK, Saeui C, Li D, Shah P, Bhattacharya R, Yarema KJ, Zhang H: Identification of sialylated glycoproteins from metabolically oligosaccharide engineered pancreatic cells. Clinical proteomics 2015, 12:11.
5Goyallon A, Cholet S, Chapelle M, Junot C, Fenaille F: Evaluation of a combined glycomics and glycoproteomics approach for studying the major glycoproteins present in biofluids: Application to cerebrospinal fluid. Rapid Communications in Mass Spectrometry 2015, 29:461-473.
8Ma C, Zhang Q, Qu JY, Zhao XY, Li X, Liu YP, Wang PG: A precise approach in large scale core-fucosylated glycoprotein identification with low- and high-normalized collision energy. Journal of Proteomics 2015, 114:61-70.
10Tan ZJ, Yin HD, Nie S, Lin ZX, Zhu JH, Ruffin MT, Anderson MA, Simone DM, Lubman DM: Large-Scale Identification of Core-Fucosylated Glycopeptide Sites in Pancreatic Cancer Serum Using Mass Spectrometry. Journal of Proteome Research 2015, 14:1968-1978.
11Wang M, Zhang X, Deng C: Facile synthesis of magnetic poly(styrene-co-4-vinylbenzene-boronic acid) microspheres for selective enrichment of glycopeptides. Proteomics 2015, 15:2158-2165.
13Yang W, Laeyendecker O, Wendel SK, Zhang B, Sun S, Zhou J-Y, Ao M, Moore RD, Jackson JB, Zhang H: Glycoproteomic Study Reveals Altered Plasma Proteins Associated with HIV Elite Suppressors. Theranostics 2014, 4:1153.
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
15Chen R, Seebun D, Ye M, Zou H, Figeys D: Site-specific characterization of cell membrane N-glycosylation with integrated hydrophilic interaction chromatography solid phase extraction and LC-MS/MS. Journal of Proteomics 2014, 103:194-203.
27Wang J, Zhou C, Zhang W, Yao J, Lu HJ, Dong QZ, Zhou HJ, Qin LX: An integrative strategy for quantitative analysis of the N-glycoproteome in complex biological samples. Proteome Science 2014, 12.
31Zhang L, Jiang H, Yao J, Wang Y, Fang C, Yang P, Lu H: Highly specific enrichment of N-linked glycopeptides based on hydrazide functionalized soluble nanopolymers. Chemical Communications 2014, 50:1027-1029.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
35Chen J, Shah P, Zhang H: Solid phase extraction of N-linked glycopeptides using hydrazide tip. Analytical chemistry 2013, 85:10670-10674.
36Li QK, Shah P, Li Y, Aiyetan PO, Chen J, Yung R, Molena D, Gabrielson E, Askin F, Chan DW: Glycoproteomic analysis of bronchoalveolar lavage (BAL) fluid identifies tumor-associated glycoproteins from lung adenocarcinoma. Journal of proteome research 2013, 12:3689-3696.
38Kaji H, Ocho M, Togayachi A, Kuno A, Sogabe M, Ohkura T, Nozaki H, Angata T, Chiba Y, Ozaki H, et al: Glycoproteomic Discovery of Serological Biomarker Candidates for HCV/HBV Infection-Associated Liver Fibrosis and Hepatocellular Carcinoma. Journal of Proteome Research 2013, 12:2630-2640.
39Li QK, Shah P, Li Y, Aiyetan PO, Chen J, Yung R, Molena D, Gabrielson E, Askin F, Chan DW, Zhang H: Glycoproteomic Analysis of Bronchoalveolar Lavage (BAL) Fluid Identifies Tumor-Associated Glycoproteins from Lung Adenocarcinonna. Journal of Proteome Research 2013, 12:3689-3696.
42Ma C, Zhao X, Han H, Tong W, Zhang Q, Qin P, Chang C, Peng B, Ying W, Qian X: N-linked glycoproteome profiling of human serum using tandem enrichment and multiple fraction concatenation. Electrophoresis 2013, 34:2440-2450.
45Zhou H, Froehlich JW, Briscoe AC, Lee RS: The GlycoFilter: A Simple and Comprehensive Sample Preparation Platform for Proteomics, N-Glycomics and Glycosylation Site Assignment. Molecular & Cellular Proteomics 2013, 12:2981-2991.
49Kim JY, Kim S-K, Kang D, Moon MH: Dual Lectin-Based Size Sorting Strategy to Enrich Targeted N-Glycopeptides by Asymmetrical Flow Field-Flow Fractionation: Profiling Lung Cancer Biomarkers. Analytical Chemistry 2012, 84:5343-5350.
53Zhu J, Wang F, Chen R, Cheng K, Xu B, Guo Z, Liang X, Ye M, Zou H: Centrifugation Assisted Microreactor Enables Facile Integration of Trypsin Digestion, Hydrophilic Interaction Chromatography Enrichment, and On-Column Deglycosylation for Rapid and Sensitive N-Glycoproteome Analysis. Analytical Chemistry 2012, 84:5146-5153.
56Bandhakavi S, Van Riper SK, Tawfik PN, Stone MD, Haddad T, Rhodus NL, Carlis JV, Griffin TJ: Hexapeptide Libraries for Enhanced Protein PTM Identification and Relative Abundance Profiling in Whole Human Saliva. Journal of Proteome Research 2011, 10:1052-1061.
59Lee H-J, Na K, Choi E-Y, Kim KS, Kim H, Paik Y-K: Simple Method for Quantitative Analysis of N-Linked Glycoproteins in Hepatocellular Carcinoma Specimens. Journal of Proteome Research 2010, 9:308-318.
60Liu Z, Cao L, He Y, Qiao L, Xu C, Lu H, Yang P: Tandem O-18 Stable Isotope Labeling for Quantification of N-Glycoproteome. Journal of Proteome Research 2010, 9:227-236.
64Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res 2009, 8:651-661.
66Jia W, Lu Z, Fu Y, Wang H-P, Wang L-H, Chi H, Yuan Z-F, Zheng Z-B, Song L-N, Han H-H, et al: A Strategy for Precise and Large Scale Identification of Core Fucosylated Glycoproteins. Molecular & Cellular Proteomics 2009, 8:913-923.
69Calvano CD, Zambonin CG, Jensen ON: Assessment of lectin and HILIC based enrichment protocols for characterization of serum glycoproteins by mass spectrometry. Journal of Proteomics 2008, 71:304-317.
71Hagglund P, Matthiesen R, Elortza F, Hojrup P, Roepstorff P, Jensen ON, Bunkenborg J: An enzymatic deglycosylation scheme enabling identification of core fucosylated N-glycans and O-glycosylation site mapping of human plasma proteins. Journal of Proteome Research 2007, 6:3021-3031.
80Qiu RQ, Regnier FE: Use of multidimensional lectin affinity chromatography in differential glycoproteomics. Analytical Chemistry 2005, 77:2802-2809.
81Liu T, Qian WJ, Gritsenko MA, Camp DG, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. Journal of Proteome Research 2005, 4:2070-2080.