Contains      

UniProtKB-P02750

Protein Leucine-rich alpha-2-glycoprotein
Gene LRG1
Status Reviewed
Source Bladder tumor; Breast Cancer cell lines; Breast cancer cell lines; Breast cancer xenografts; Breast tumor; Cerebrospinal fluid; Colorectal tumor; DLBCL cell lines (Diffuse large B-cell lymphoma); HCC cell lines (Liver); HCCLM3 cell line (Liver); HepG2 cell line (Liver); HuH-7 cell line (Liver); Liver; Lung Adenocarcinoma; Lung tumor; Ovarian tumor; Pancreatic islets; Plasma; Platelet; Prostate; Prostate cancer metastasis to liver; Prostate tumor; Saliva; Serum; Serum (Colorectal cancer); Serum (HCC); Urine; lung; milk; ovarian tumor; plasma
Years 2004-20072007

Glycosites

Site Identified Peptides Year(Publication ID)
79 nLTHLPANL 2014(33);
79 nLTHLPANLL 2014(33);
79 FFnLTHLPANL 2014(33);
79 nLTHLPANLLQGASK 2007(60); 2010(33); 2014(unpublished);2007(unpublished);2007(unpublished);2007(unpublished);2007(unpublished);2007(unpublished);2007(Unpublished ); 2007 ;
79 FFnLTHLPANLLQGASK 2014(33);
79 LAVEFFnLTHLPANLLQGASK 2015(unpublished);
79 SDHGSSISCQPPAEIPGYLPADTVHLAVEFFnLTHLPANLLQGASK 2014(13); 2014(35); 2014(20); 2015(unpublished);
186 LPPGLLAnF 2014(33);
186 KLPPGLLAnF 2014(33); 2015(unpublished);
186 KLPPGLLAnFT 2014(14); 2015(unpublished);
186 LPPGLLAnFTL 2014(14); 2015(unpublished);
186 KLPPGLLAnFTL 2014(14); 2015(unpublished);
186 LPPGLLAnFTLLR 2004( 82); 2005(81); 2007(70); 2008(63); 2009(66); 2009(40); 2010(49); 2012(53); 2012(34); 2013(38); 2013(38); 2013(38); 2013(42); 2013(45); 2013(13); 2014(35); 2014(31); 2014(33); 2014(5); 2015(10); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2007(unpublished);2007(UnpublishedUnpublished ); 2007;2007;2007;2007;2007;20072007 ;
186 PPGIIAnFTIIRT 2013(37);
186 KLPPGLLAnFTLLR 2004(82); 2005(79); 2005(80); 2006(76); 2006(77); 2010(59); 2010(40); 2012(53); 2013(34); 2013(38); 2013(38); 2013(40); 2013(42); 2013(45); 2013(45); 2014(13); 2014(35); 2014(24); 2014(31); 2014(33); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(11);
269 LSnNSLASVPE 2013(42);
269 MLDLSnNSLASVPE 2013(42);
269 QLDMLDLSnNSLASVPE 2014(33);
269 QLDMLDLSnNSLASVPEGLWASLGQPNWDMR 2005( 81); 2012(53); 2013(45); 2014(35); 2015(unpublished);2007(unpublished);2007(unpublished);2007(unpublished);2007(UnpublishedUnpublished ); 20072007 ;
306 DGFDISGNPWICDQnLSDLYR 2014(20); 2015(unpublished);2007(unpublished);2007;
325 MFSQnDTR 2005( 81); 2007(66); 2009(54); 2011(48); 2012(53); 2012(38); 2013(38); 2013(38); 2013(38); 2013(39); 2013(40); 2013(42); 2013(45); 2013(45); 2013(13); 2014(36); 2014(16); 2014(21); 2014(22); 2014(31); 2014(33); 2014(7); 2015(10); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015;2015;2007;2007;2007;2007;2007;
325 DKMFSQnDTR 2012(53); 2013(38); 2013(38); 2013(42); 2013(45); 2014(13); 2014(24); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);
325 DKMFSQnDTRCAG 2013(37);
325 MFSQnDTRCAGPEAVK 2013(38); 2013(38);
325 SQnDTRCAGPEAVKGQTL 2014(33);

Sequence

1112131415161718191
MSSWSRQRPKSPGGIQPHVSRTLFLLLLLAASAWGVTLSPKDCQVFRSDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLPANLLQGASKLQELHLS
101111121131141151161171181191
SNGLESLSPEFLRPVPQLRVLDLTRNALTGLPPGLFQASATLDTLVLKENQLEVLEVSWLHGLKALGHLDLSGNRLRKLPPGLLANFTLLRTLDLGENQL
201211221231241251261271281291
ETLPPDLLRGPLQLERLHLEGNKLQVLGKDLLLPQPDLRYLFLNGNKLARVAAGAFQGLRQLDMLDLSNNSLASVPEGLWASLGQPNWDMRDGFDISGNP
301311321331341
WICDQNLSDLYRWLQAQKDKMFSQNDTRCAGPEAVKGQTLLAVAKSQ

Reference

ID Publication
5Goyallon A, Cholet S, Chapelle M, Junot C, Fenaille F: Evaluation of a combined glycomics and glycoproteomics approach for studying the major glycoproteins present in biofluids: Application to cerebrospinal fluid. Rapid Communications in Mass Spectrometry 2015, 29:461-473.
7Li Y, Shah P, De Marzo AM, Van Eyk JE, Lo Q, Chan DW, Zhang H: Identification of Glycoproteins Containing Specific Glycans Using a Lectin-Chemical Method. Analytical Chemistry 2015, 87:4683-4687.
10Tan ZJ, Yin HD, Nie S, Lin ZX, Zhu JH, Ruffin MT, Anderson MA, Simone DM, Lubman DM: Large-Scale Identification of Core-Fucosylated Glycopeptide Sites in Pancreatic Cancer Serum Using Mass Spectrometry. Journal of Proteome Research 2015, 14:1968-1978.
11Wang M, Zhang X, Deng C: Facile synthesis of magnetic poly(styrene-co-4-vinylbenzene-boronic acid) microspheres for selective enrichment of glycopeptides. Proteomics 2015, 15:2158-2165.
13Yang W, Laeyendecker O, Wendel SK, Zhang B, Sun S, Zhou J-Y, Ao M, Moore RD, Jackson JB, Zhang H: Glycoproteomic Study Reveals Altered Plasma Proteins Associated with HIV Elite Suppressors. Theranostics 2014, 4:1153.
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
16Deeb SJ, Cox J, Schmidt-Supprian M, Mann M: N-linked Glycosylation Enrichment for In-depth Cell Surface Proteomics of Diffuse Large B-cell Lymphoma Subtypes. Molecular & Cellular Proteomics 2014, 13:240-251.
20Kim JY, Oh D, Kim S-K, Kang D, Moon MH: Isotope-Coded Carbamidomethylation for Quantification of N-Glycoproteins with Online Microbore Hollow Fiber Enzyme Reactor-Nanoflow Liquid Chromatography-Tandem Mass Spectrometry. Analytical Chemistry 2014, 86:7650-7657.
21Liu L, Yu M, Zhang Y, Wang C, Lu H: Hydrazide Functionalized Core-Shell Magnetic Nanocomposites for Highly Specific Enrichment of N-Glycopeptides. Acs Applied Materials & Interfaces 2014, 6:7823-7832.
22Nicastri A, Gaspari M, Sacco R, Elia L, Gabriele C, Romano R, Rizzuto A, Cuda G: N-Glycoprotein Analysis Discovers New Up-Regulated Glycoproteins in Colorectal Cancer Tissue. Journal of Proteome Research 2014, 13:4932-4941.
24Song E, Zhu R, Hammond ZT, Mechref Y: LC-MS/MS Quantitation of Esophagus Disease Blood Serum Glycoproteins by Enrichment with Hydrazide Chemistry and Lectin Affinity Chromatography. Journal of Proteome Research 2014, 13:4808-4820.
31Zhang L, Jiang H, Yao J, Wang Y, Fang C, Yang P, Lu H: Highly specific enrichment of N-linked glycopeptides based on hydrazide functionalized soluble nanopolymers. Chemical Communications 2014, 50:1027-1029.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
34Sun S, Zhang B, Aiyetan P, Zhou J-Y, Shah P, Yang W, Levine DA, Zhang Z, Chan DW, Zhang H: Analysis of N-glycoproteins using Genomic N-glycosite Prediction. Journal of Proteome Research 2013, 12:5609-5615.
35Chen J, Shah P, Zhang H: Solid phase extraction of N-linked glycopeptides using hydrazide tip. Analytical chemistry 2013, 85:10670-10674.
36Li QK, Shah P, Li Y, Aiyetan PO, Chen J, Yung R, Molena D, Gabrielson E, Askin F, Chan DW: Glycoproteomic analysis of bronchoalveolar lavage (BAL) fluid identifies tumor-associated glycoproteins from lung adenocarcinoma. Journal of proteome research 2013, 12:3689-3696.
37Boersema PJ, Geiger T, Wisniewski JR, Mann M: Quantification of the N-glycosylated Secretome by Super-SILAC During Breast Cancer Progression and in Human Blood Samples. Molecular & Cellular Proteomics 2013, 12:158-171.
38Kaji H, Ocho M, Togayachi A, Kuno A, Sogabe M, Ohkura T, Nozaki H, Angata T, Chiba Y, Ozaki H, et al: Glycoproteomic Discovery of Serological Biomarker Candidates for HCV/HBV Infection-Associated Liver Fibrosis and Hepatocellular Carcinoma. Journal of Proteome Research 2013, 12:2630-2640.
39Li QK, Shah P, Li Y, Aiyetan PO, Chen J, Yung R, Molena D, Gabrielson E, Askin F, Chan DW, Zhang H: Glycoproteomic Analysis of Bronchoalveolar Lavage (BAL) Fluid Identifies Tumor-Associated Glycoproteins from Lung Adenocarcinonna. Journal of Proteome Research 2013, 12:3689-3696.
40Li X, Jiang J, Zhao X, Wang J, Han H, Zhao Y, Peng B, Zhong R, Ying W, Qian X: N-glycoproteome Analysis of the Secretome of Human Metastatic Hepatocellular Carcinoma Cell Lines Combining Hydrazide Chemistry, HILIC Enrichment and Mass Spectrometry. Plos One 2013, 8.
42Ma C, Zhao X, Han H, Tong W, Zhang Q, Qin P, Chang C, Peng B, Ying W, Qian X: N-linked glycoproteome profiling of human serum using tandem enrichment and multiple fraction concatenation. Electrophoresis 2013, 34:2440-2450.
45Zhou H, Froehlich JW, Briscoe AC, Lee RS: The GlycoFilter: A Simple and Comprehensive Sample Preparation Platform for Proteomics, N-Glycomics and Glycosylation Site Assignment. Molecular & Cellular Proteomics 2013, 12:2981-2991.
48Danzer C, Eckhardt K, Schmidt A, Fankhauser N, Ribrioux S, Wollscheid B, Mueller L, Schiess R, Zuellig R, Lehmann R, et al: Comprehensive Description of the N-Glycoproteome of Mouse Pancreatic beta-Cells and Human Islets. Journal of Proteome Research 2012, 11:1598-1608.
49Kim JY, Kim S-K, Kang D, Moon MH: Dual Lectin-Based Size Sorting Strategy to Enrich Targeted N-Glycopeptides by Asymmetrical Flow Field-Flow Fractionation: Profiling Lung Cancer Biomarkers. Analytical Chemistry 2012, 84:5343-5350.
53Zhu J, Wang F, Chen R, Cheng K, Xu B, Guo Z, Liang X, Ye M, Zou H: Centrifugation Assisted Microreactor Enables Facile Integration of Trypsin Digestion, Hydrophilic Interaction Chromatography Enrichment, and On-Column Deglycosylation for Rapid and Sensitive N-Glycoproteome Analysis. Analytical Chemistry 2012, 84:5146-5153.
54Tian Y, Yao Z, Roden R, Zhang H: Identification of glycoproteins associated with different histological subtypes of ovarian tumors using quantitative glycoproteomics. Proteomics 2011, 11:4677-4687.
59Lee H-J, Na K, Choi E-Y, Kim KS, Kim H, Paik Y-K: Simple Method for Quantitative Analysis of N-Linked Glycoproteins in Hepatocellular Carcinoma Specimens. Journal of Proteome Research 2010, 9:308-318.
60Liu Z, Cao L, He Y, Qiao L, Xu C, Lu H, Yang P: Tandem O-18 Stable Isotope Labeling for Quantification of N-Glycoproteome. Journal of Proteome Research 2010, 9:227-236.
63Cao J, Shen C, Wang H, Shen H, Chen Y, Nie A, Yan G, Lu H, Liu Y, Yang P: Identification of N-Glycosylation Sites on Secreted Proteins of Human Hepatocellular Carcinoma Cells with a Complementary Proteomics Approach. Journal of Proteome Research 2009, 8:662-672.
66Jia W, Lu Z, Fu Y, Wang H-P, Wang L-H, Chi H, Yuan Z-F, Zheng Z-B, Song L-N, Han H-H, et al: A Strategy for Precise and Large Scale Identification of Core Fucosylated Glycoproteins. Molecular & Cellular Proteomics 2009, 8:913-923.
70Picariello G, Ferranti P, Mamone G, Roepstorff P, Addeo F: Identification of N-linked glycoproteins in human milk by hydrophilic interaction liquid chromatography and mass spectrometry. Proteomics 2008, 8:3833-3847.
76Alvarez-Manilla G, Atwood J, Guo Y, Warren NL, Orlando R, Pierce M: Tools for glycoproteomic analysis: Size exclusion chromatography facilitates identification of tryptic glycopeptides with N-linked glycosylation sites. Journal of Proteome Research 2006, 5:701-708.
77Ramachandran P, Boontheung P, Xie YM, Sondej M, Wong DT, Loo JA: Identification of N-linked glycoproteins in human saliva by glycoprotein capture and mass spectrometry. Journal of Proteome Research 2006, 5:1493-1503.
79Qiu RQ, Regnier FE: Comparative glycoproteomics of N-linked complex-type glycoforms containing sialic acid in human serum. Analytical Chemistry 2005, 77:7225-7231.
80Qiu RQ, Regnier FE: Use of multidimensional lectin affinity chromatography in differential glycoproteomics. Analytical Chemistry 2005, 77:2802-2809.
81Liu T, Qian WJ, Gritsenko MA, Camp DG, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. Journal of Proteome Research 2005, 4:2070-2080.
82Hagglund P, Bunkenborg J, Elortza F, Jensen ON, Roepstorff P: A new strategy for identification of N-glycosylated proteins and unambiguous assignment of their glycosylation sites using HILIC enrichment and partial deglycosylation. Journal of Proteome Research 2004, 3:556-566.