Contains      

UniProtKB-P04196

Protein Histidine-rich glycoprotein
Gene HRG
Status Reviewed
Source Bladder tumor; Breast tumor; Cerebrospinal fluid; Colorectal tumor; HCC cell lines (Liver); HEK293 cell line (embryonic kidney); Human; K562A cell line (Leukemia); Liver; Liver tumor (HCC); Lung Adenocarcinoma; Lung tumor; Ovarian tumor; Plasma; Platelet; Prostate; Prostate cancer metastasis to liver; Prostate tumor; Serum; Serum (Colorectal cancer); Serum (HCC); Urine; lung; ovarian tumor; plasma
Years 2005-20072007

Glycosites

Site Identified Peptides Year(Publication ID)
63 VEnTTVYY 2014(33);
63 DRVEnTTVY 2014(33);
63 VEnTTVYYLVLD 2014(33);
63 IADAHLDRVEnTTVY 2005(79); 2005(80); 2014(21); 2014(28); 2014(33); 2015(unpublished);
63 VEnTTVYYLVLDVQE 2014(33);
63 IADAHLDRVEnTTVYY 2014(21); 2014(33);
63 RIADAHLDRVEnTTVY 2014(33);
63 LRIADAHLDRVEnTTVY 2014(33);
63 RIADAHLDRVEnTTVYY 2014(33);
63 QLLRIADAHLDRVEnTTVY 2014(33);
63 IADAHLDRVEnTTVYYLVLD 2015(6);
63 IADAHLDRVEnTTVYYLVLDVQE 2014(33);
63 VEnTTVYYIVIDVQESDCSVISR 2014(32);
63 VEnTTVYYLVLDVQESDCSVLSR 2005( 81); 2012(53); 2014(13); 2014(35); 2014(15); 2014(33); 2015(8); 2015(10); 2015(unpublished);2015(unpublished);2007(unpublished);2007(unpublished);2007(unpublished);2007;2007;
63 IADAHIDRVEnTTVYYIVIDVQESDCSVISR 2014(32); 2014(32);
63 IADAHLDRVEnTTVYYLVLDVQESDCSVLSR 2012(53); 2013(42); 2014(13); 2014(35); 2014(20); 2014(31); 2014(33); 2015(unpublished);2015(unpublished);
125 RVIDFnCTTS 2014(33);
125 VIDFnCTTSSVS 2014(33);
125 RVIDFnCTTSSVS 2014(33);
125 VIDFnCTTSSVSSAL 2012(49); 2014(33);
125 RVIDFnCTTSSVSSAL 2014(33);
125 VIDFnCTTSSVSSALA 2014(33);
125 VIDFnCTTSSVSSALAN 2014(33);
125 DLRVIDFnCTTSSVSSAL 2014(33);
125 IDFnCTTSSVSSALANTK 2015(unpublished);
125 VIDFnCTTSSVSSAIANTK 2014(32); 2014(32);
125 VIDFnCTTSSVSSALANTK 2005( 81); 2007(71); 2007(69); 2008(64); 2009(59); 2010(60); 2010(40); 2010(54); 2011(53); 2012(34); 2013(38); 2013(38); 2013(39); 2013(40); 2013(42); 2013(45); 2013(13); 2014(14); 2014(35); 2014(36); 2014(15); 2014(19); 2014(20); 2014(21); 2014(22); 2014(25); 2014(26); 2014(28); 2014(31); 2014(33); 2014(5); 2015(11); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(UnpublishedUnpublished ); 2007;2007;2007;2007;2007;2007;20072007 ;
125 VIDFnCTTSSVSSALANTKD 2014(33);
125 SHESQDLRVIDFnCTTSSVSSALANTK 2014(33);
125 VIDFnCTTSSVSSALANTKDSPVLIDFFEDTER 2012(53); 2013(45); 2014(35); 2015(unpublished);
344 SHNnNSSDLHPHK 2014(33); 2015(unpublished);
344 HSHNnNSSDLHPHK 2005( 81); 2009(66); 2012(53); 2013(45); 2013(45); 2014(13); 2014(28); 2014(33); 2015(8); 2015(10); 2015(unpublished);2015(unpublished);2007(unpublished);2007(unpublished);2007;2007;
344 HSHNnNSSDLHPHKHHSHEQHPHGHHPHAHHPHEHDTHR 2015(unpublished);
345 nSSDLHPHK 2014(33);
345 SHNNnSSDLHPHK 2014(33); 2015(unpublished);
345 HSHNNnSSDLHPHK 2005( 81); 2009(66); 2012(53); 2013(45); 2013(45); 2014(13); 2014(28); 2014(33); 2015(8); 2015(10); 2015(unpublished);2015(unpublished);2007(unpublished);2007(unpublished);2007;2007;
345 HSHNNnSSDLHPHKHHSHEQHPHGHHPHAHHPHEHDTHR 2015(unpublished);

Sequence

1112131415161718191
MKALIAALLLITLQYSCAVSPTDCSAVEPEAEKALDLINKRRRDGYLFQLLRIADAHLDRVENTTVYYLVLDVQESDCSVLSRKYWNDCEPPDSRRPSEI
101111121131141151161171181191
VIGQCKVIATRHSHESQDLRVIDFNCTTSSVSSALANTKDSPVLIDFFEDTERYRKQANKALEKYKEENDDFASFRVDRIERVARVRGGEGTGYFVDFSV
201211221231241251261271281291
RNCPRHHFPRHPNVFGFCRADLFYDVEALDLESPKNLVINCEVFDPQEHENINGVPPHLGHPFHWGGHERSSTTKPPFKPHGSRDHHHPHKPHEHGPPPP
301311321331341351361371381391
PDERDHSHGPPLPQGPPPLLPMSCSSCQHATFGTNGAQRHSHNNNSSDLHPHKHHSHEQHPHGHHPHAHHPHEHDTHRQHPHGHHPHGHHPHGHHPHGHH
401411421431441451461471481491
PHGHHPHCHDFQDYGPCDPPPHNQGHCCHGHGPPPGHLRRRGPGKGPRPFHCRQIGSVYRLPPLRKGEVLPLPEANFPSFPLPHHKHPLKPDNQPFPQSV
501511521
SESCPGKFKSGFPQVSMFFTHTFPK

Reference

ID Publication
5Goyallon A, Cholet S, Chapelle M, Junot C, Fenaille F: Evaluation of a combined glycomics and glycoproteomics approach for studying the major glycoproteins present in biofluids: Application to cerebrospinal fluid. Rapid Communications in Mass Spectrometry 2015, 29:461-473.
6Kim DS, Hahn Y: The acquisition of novel N-glycosylation sites in conserved proteins during human evolution. Bmc Bioinformatics 2015, 16.
8Ma C, Zhang Q, Qu JY, Zhao XY, Li X, Liu YP, Wang PG: A precise approach in large scale core-fucosylated glycoprotein identification with low- and high-normalized collision energy. Journal of Proteomics 2015, 114:61-70.
10Tan ZJ, Yin HD, Nie S, Lin ZX, Zhu JH, Ruffin MT, Anderson MA, Simone DM, Lubman DM: Large-Scale Identification of Core-Fucosylated Glycopeptide Sites in Pancreatic Cancer Serum Using Mass Spectrometry. Journal of Proteome Research 2015, 14:1968-1978.
11Wang M, Zhang X, Deng C: Facile synthesis of magnetic poly(styrene-co-4-vinylbenzene-boronic acid) microspheres for selective enrichment of glycopeptides. Proteomics 2015, 15:2158-2165.
13Yang W, Laeyendecker O, Wendel SK, Zhang B, Sun S, Zhou J-Y, Ao M, Moore RD, Jackson JB, Zhang H: Glycoproteomic Study Reveals Altered Plasma Proteins Associated with HIV Elite Suppressors. Theranostics 2014, 4:1153.
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
15Chen R, Seebun D, Ye M, Zou H, Figeys D: Site-specific characterization of cell membrane N-glycosylation with integrated hydrophilic interaction chromatography solid phase extraction and LC-MS/MS. Journal of Proteomics 2014, 103:194-203.
19Huang G, Sun Z, Qin H, Zhao L, Xiong Z, Peng X, Ou J, Zou H: Preparation of hydrazine functionalized polymer brushes hybrid magnetic nanoparticles for highly specific enrichment of glycopeptides. Analyst 2014, 139:2199-2206.
20Kim JY, Oh D, Kim S-K, Kang D, Moon MH: Isotope-Coded Carbamidomethylation for Quantification of N-Glycoproteins with Online Microbore Hollow Fiber Enzyme Reactor-Nanoflow Liquid Chromatography-Tandem Mass Spectrometry. Analytical Chemistry 2014, 86:7650-7657.
21Liu L, Yu M, Zhang Y, Wang C, Lu H: Hydrazide Functionalized Core-Shell Magnetic Nanocomposites for Highly Specific Enrichment of N-Glycopeptides. Acs Applied Materials & Interfaces 2014, 6:7823-7832.
22Nicastri A, Gaspari M, Sacco R, Elia L, Gabriele C, Romano R, Rizzuto A, Cuda G: N-Glycoprotein Analysis Discovers New Up-Regulated Glycoproteins in Colorectal Cancer Tissue. Journal of Proteome Research 2014, 13:4932-4941.
25Sun Z, Dong J, Zhang S, Hu Z, Cheng K, Li K, Xu B, Ye M, Nie Y, Fan D, Zou H: Identification of Chemoresistance-Related Cell-Surface Glycoproteins in Leukemia Cells and Functional Validation of Candidate Glycoproteins. Journal of Proteome Research 2014, 13:1593-1601.
26Takakura D, Harazono A, Hashii N, Kawasaki N: Selective glycopeptide profiling by acetone enrichment and LC/MS. Journal of Proteomics 2014, 101:17-30.
28Wang Y, Liu M, Xie L, Fang C, Xiong H, Lu H: Highly Efficient Enrichment Method for Glycopeptide Analyses: Using Specific and Nonspecific Nanoparticles Synergistically. Analytical Chemistry 2014, 86:2057-2064.
31Zhang L, Jiang H, Yao J, Wang Y, Fang C, Yang P, Lu H: Highly specific enrichment of N-linked glycopeptides based on hydrazide functionalized soluble nanopolymers. Chemical Communications 2014, 50:1027-1029.
32Zhang Z, Sun Z, Zhu J, Liu J, Huang G, Ye M, Zou H: High-Throughput Determination of the Site-Specific N-Sialoglycan Occupancy Rates by Differential Oxidation of Glycoproteins Followed with Quantitative Glycoproteomics Analysis. Analytical Chemistry 2014, 86:9830-9837.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
34Sun S, Zhang B, Aiyetan P, Zhou J-Y, Shah P, Yang W, Levine DA, Zhang Z, Chan DW, Zhang H: Analysis of N-glycoproteins using Genomic N-glycosite Prediction. Journal of Proteome Research 2013, 12:5609-5615.
35Chen J, Shah P, Zhang H: Solid phase extraction of N-linked glycopeptides using hydrazide tip. Analytical chemistry 2013, 85:10670-10674.
36Li QK, Shah P, Li Y, Aiyetan PO, Chen J, Yung R, Molena D, Gabrielson E, Askin F, Chan DW: Glycoproteomic analysis of bronchoalveolar lavage (BAL) fluid identifies tumor-associated glycoproteins from lung adenocarcinoma. Journal of proteome research 2013, 12:3689-3696.
38Kaji H, Ocho M, Togayachi A, Kuno A, Sogabe M, Ohkura T, Nozaki H, Angata T, Chiba Y, Ozaki H, et al: Glycoproteomic Discovery of Serological Biomarker Candidates for HCV/HBV Infection-Associated Liver Fibrosis and Hepatocellular Carcinoma. Journal of Proteome Research 2013, 12:2630-2640.
39Li QK, Shah P, Li Y, Aiyetan PO, Chen J, Yung R, Molena D, Gabrielson E, Askin F, Chan DW, Zhang H: Glycoproteomic Analysis of Bronchoalveolar Lavage (BAL) Fluid Identifies Tumor-Associated Glycoproteins from Lung Adenocarcinonna. Journal of Proteome Research 2013, 12:3689-3696.
40Li X, Jiang J, Zhao X, Wang J, Han H, Zhao Y, Peng B, Zhong R, Ying W, Qian X: N-glycoproteome Analysis of the Secretome of Human Metastatic Hepatocellular Carcinoma Cell Lines Combining Hydrazide Chemistry, HILIC Enrichment and Mass Spectrometry. Plos One 2013, 8.
42Ma C, Zhao X, Han H, Tong W, Zhang Q, Qin P, Chang C, Peng B, Ying W, Qian X: N-linked glycoproteome profiling of human serum using tandem enrichment and multiple fraction concatenation. Electrophoresis 2013, 34:2440-2450.
45Zhou H, Froehlich JW, Briscoe AC, Lee RS: The GlycoFilter: A Simple and Comprehensive Sample Preparation Platform for Proteomics, N-Glycomics and Glycosylation Site Assignment. Molecular & Cellular Proteomics 2013, 12:2981-2991.
49Kim JY, Kim S-K, Kang D, Moon MH: Dual Lectin-Based Size Sorting Strategy to Enrich Targeted N-Glycopeptides by Asymmetrical Flow Field-Flow Fractionation: Profiling Lung Cancer Biomarkers. Analytical Chemistry 2012, 84:5343-5350.
53Zhu J, Wang F, Chen R, Cheng K, Xu B, Guo Z, Liang X, Ye M, Zou H: Centrifugation Assisted Microreactor Enables Facile Integration of Trypsin Digestion, Hydrophilic Interaction Chromatography Enrichment, and On-Column Deglycosylation for Rapid and Sensitive N-Glycoproteome Analysis. Analytical Chemistry 2012, 84:5146-5153.
54Tian Y, Yao Z, Roden R, Zhang H: Identification of glycoproteins associated with different histological subtypes of ovarian tumors using quantitative glycoproteomics. Proteomics 2011, 11:4677-4687.
59Lee H-J, Na K, Choi E-Y, Kim KS, Kim H, Paik Y-K: Simple Method for Quantitative Analysis of N-Linked Glycoproteins in Hepatocellular Carcinoma Specimens. Journal of Proteome Research 2010, 9:308-318.
60Liu Z, Cao L, He Y, Qiao L, Xu C, Lu H, Yang P: Tandem O-18 Stable Isotope Labeling for Quantification of N-Glycoproteome. Journal of Proteome Research 2010, 9:227-236.
64Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res 2009, 8:651-661.
66Jia W, Lu Z, Fu Y, Wang H-P, Wang L-H, Chi H, Yuan Z-F, Zheng Z-B, Song L-N, Han H-H, et al: A Strategy for Precise and Large Scale Identification of Core Fucosylated Glycoproteins. Molecular & Cellular Proteomics 2009, 8:913-923.
69Calvano CD, Zambonin CG, Jensen ON: Assessment of lectin and HILIC based enrichment protocols for characterization of serum glycoproteins by mass spectrometry. Journal of Proteomics 2008, 71:304-317.
71Hagglund P, Matthiesen R, Elortza F, Hojrup P, Roepstorff P, Jensen ON, Bunkenborg J: An enzymatic deglycosylation scheme enabling identification of core fucosylated N-glycans and O-glycosylation site mapping of human plasma proteins. Journal of Proteome Research 2007, 6:3021-3031.
79Qiu RQ, Regnier FE: Comparative glycoproteomics of N-linked complex-type glycoforms containing sialic acid in human serum. Analytical Chemistry 2005, 77:7225-7231.
80Qiu RQ, Regnier FE: Use of multidimensional lectin affinity chromatography in differential glycoproteomics. Analytical Chemistry 2005, 77:2802-2809.