Contains      

UniProtKB-P04220

Protein Ig mu heavy chain disease protein
Gene NULL
Status Reviewed
Source Bladder tumor; Breast tumor; Cerebrospinal fluid; DLBCL cell lines (Diffuse large B-cell lymphoma); Liver; Lymphocytes; Ovarian tumor; Plasma; Prostate; Prostate cancer metastasis to liver; Prostate tumor; Serum; Urine; plasma
Years 2005-20072007

Glycosites

Site Identified Peptides Year(Publication ID)
147 TFQQnASSM 2014(33);
147 GLTFQQnASSM 2014(27); 2014(33);
147 GLTFQQnASSMCGPDQDTAIR 2010(40); 2014(13); 2014(35); 2014(33); 2015(8); 2015(10); 2007(unpublished);2007(unpublished);2007(unpublished);2007(unpublished);2007(unpublished);2007(unpublished);20072007 (UnpublishedUnpublished );
147 GLTFQQnASSMCGPDQDTAIRV 2014(27);
147 VDHRGLTFQQnASSMCGPDQDTAIR 2015(8);
210 THTnISE 2014(33);
210 AVKTHTnISE 2013(42); 2014(33);
210 TnISESHPNATF 2014(33);
210 THTnISESHPNAT 2012(3); 2014(14); 2014(27); 2014(33); 2015(unpublished);
210 THTnISESHPNATF 2007(unpublished);2014(27); 2014(28); 2014(33);
210 THTnISESHPNATFS 2014(27);
210 THTnISESHPNATFSAVG 2014(27);
210 THTnISESHPNATFSAVGE 2014(27); 2014(33);
210 TRQDGEAVKTHTnISESHPNATF 2014(33);
210 THTnISESHPNATFSAVGEASICEDDWDSGER 2013(42); 2014(13); 2014(16); 2014(33); 2015(10); 2015(11); 2007(unpublished);2007(unpublished);2007(unpublished);2007(unpublished);2007(unpublished);
217 ISESHPnAT 2009(64);
217 SHPnATFSAVGE 2013(42); 2014(33);
217 TNISESHPnATF 2014(33);
217 THTNISESHPnAT 2012(3); 2014(14); 2014(27); 2014(33); 2015(unpublished);
217 THTNISESHPnATF 2007(unpublished);2014(27); 2014(28); 2014(33);
217 THTNISESHPnATFS 2014(27);
217 THTNISESHPnATFSAVG 2014(27);
217 THTNISESHPnATFSAVGE 2014(27); 2014(33);
217 TRQDGEAVKTHTNISESHPnATF 2014(33);
217 THTNISESHPnATFSAVGEASICEDDWDSGER 2013(42); 2014(13); 2014(16); 2014(33); 2015(10); 2015(11); 2007(unpublished);2007(unpublished);2007(unpublished);2007(unpublished);2007(unpublished);
378 STGKPTLYnVSL 2007(71);
378 nVSLVMSDTAGTC 2014(33);
378 nVSLVMSDTAGTCY 2014(33);
378 STGKPTLYnVSLVM 2007(71);
378 STGKPTLYnVSLVMS 2014(28);
378 PTLYnVSLVMSDTAGTCY 2015(8);
378 RTVDKSTGKPTLYnVSLVMSD 2013(42);
378 STGKPTLYnVSLVMSDTAGTC 2007(unpublished);2014(33);
378 STGKPTLYnVSLVMSDTAGTCY 2005(81); 2007(unpublished);2008(69); 2010(40); 2012(53); 2013(34); 2013(42); 2013(45); 2014(13); 2014(35); 2014(24); 2014(26); 2014(33);
378 TVDKSTGKPTIYnVSIVMSDTAGTCY 2014(16);
378 TVDKSTGKPTLYnVSLVMSDTAGTCY 2012(53); 2014(33);
378 RTVDKSTGKPTLYnVSLVMSDTAGTCY 2013(42);

Sequence

1112131415161718191
DSPLEQSGHEVGILKETEAEDRIIKEEEARLSGRDMQVTSQPVIAELPPKVSVFVPPRDGFFGNPRKSKLICQATGFSPRQIEVSWLREGKQVGSGVTTD
101111121131141151161171181191
EVEAEAKESGPTTYKVTSTLTIKESDWLGQSMFTCRVDHRGLTFQQNASSMCGPDQDTAIRVFAIPPSFASIFLTKSTKLTCLVTDLTTYDSVTISWTRQ
201211221231241251261271281291
DGEAVKTHTNISESHPNATFSAVGEASICEDDWDSGERFTCTVTHTDLPSPLKQTISRPKGVALHRPDVYLLPPAREQLNLRESATITCLVTGFSPADVF
301311321331341351361371381391
VQWMQRGQPLSPEKYVTSAPMPEPQAPGRYFAHSILTVSEEEWNTGETYTCVVAHEALPNRVTERTVDKSTGKPTLYNVSLVMSDTAGTCY

Reference

ID Publication
3Tian Y, Almaraz RT, Choi CH, Li QK, Saeui C, Li D, Shah P, Bhattacharya R, Yarema KJ, Zhang H: Identification of sialylated glycoproteins from metabolically oligosaccharide engineered pancreatic cells. Clinical proteomics 2015, 12:11.
8Ma C, Zhang Q, Qu JY, Zhao XY, Li X, Liu YP, Wang PG: A precise approach in large scale core-fucosylated glycoprotein identification with low- and high-normalized collision energy. Journal of Proteomics 2015, 114:61-70.
10Tan ZJ, Yin HD, Nie S, Lin ZX, Zhu JH, Ruffin MT, Anderson MA, Simone DM, Lubman DM: Large-Scale Identification of Core-Fucosylated Glycopeptide Sites in Pancreatic Cancer Serum Using Mass Spectrometry. Journal of Proteome Research 2015, 14:1968-1978.
11Wang M, Zhang X, Deng C: Facile synthesis of magnetic poly(styrene-co-4-vinylbenzene-boronic acid) microspheres for selective enrichment of glycopeptides. Proteomics 2015, 15:2158-2165.
13Yang W, Laeyendecker O, Wendel SK, Zhang B, Sun S, Zhou J-Y, Ao M, Moore RD, Jackson JB, Zhang H: Glycoproteomic Study Reveals Altered Plasma Proteins Associated with HIV Elite Suppressors. Theranostics 2014, 4:1153.
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
16Deeb SJ, Cox J, Schmidt-Supprian M, Mann M: N-linked Glycosylation Enrichment for In-depth Cell Surface Proteomics of Diffuse Large B-cell Lymphoma Subtypes. Molecular & Cellular Proteomics 2014, 13:240-251.
24Song E, Zhu R, Hammond ZT, Mechref Y: LC-MS/MS Quantitation of Esophagus Disease Blood Serum Glycoproteins by Enrichment with Hydrazide Chemistry and Lectin Affinity Chromatography. Journal of Proteome Research 2014, 13:4808-4820.
26Takakura D, Harazono A, Hashii N, Kawasaki N: Selective glycopeptide profiling by acetone enrichment and LC/MS. Journal of Proteomics 2014, 101:17-30.
27Wang J, Zhou C, Zhang W, Yao J, Lu HJ, Dong QZ, Zhou HJ, Qin LX: An integrative strategy for quantitative analysis of the N-glycoproteome in complex biological samples. Proteome Science 2014, 12.
28Wang Y, Liu M, Xie L, Fang C, Xiong H, Lu H: Highly Efficient Enrichment Method for Glycopeptide Analyses: Using Specific and Nonspecific Nanoparticles Synergistically. Analytical Chemistry 2014, 86:2057-2064.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
34Sun S, Zhang B, Aiyetan P, Zhou J-Y, Shah P, Yang W, Levine DA, Zhang Z, Chan DW, Zhang H: Analysis of N-glycoproteins using Genomic N-glycosite Prediction. Journal of Proteome Research 2013, 12:5609-5615.
35Chen J, Shah P, Zhang H: Solid phase extraction of N-linked glycopeptides using hydrazide tip. Analytical chemistry 2013, 85:10670-10674.
40Li X, Jiang J, Zhao X, Wang J, Han H, Zhao Y, Peng B, Zhong R, Ying W, Qian X: N-glycoproteome Analysis of the Secretome of Human Metastatic Hepatocellular Carcinoma Cell Lines Combining Hydrazide Chemistry, HILIC Enrichment and Mass Spectrometry. Plos One 2013, 8.
42Ma C, Zhao X, Han H, Tong W, Zhang Q, Qin P, Chang C, Peng B, Ying W, Qian X: N-linked glycoproteome profiling of human serum using tandem enrichment and multiple fraction concatenation. Electrophoresis 2013, 34:2440-2450.
45Zhou H, Froehlich JW, Briscoe AC, Lee RS: The GlycoFilter: A Simple and Comprehensive Sample Preparation Platform for Proteomics, N-Glycomics and Glycosylation Site Assignment. Molecular & Cellular Proteomics 2013, 12:2981-2991.
53Zhu J, Wang F, Chen R, Cheng K, Xu B, Guo Z, Liang X, Ye M, Zou H: Centrifugation Assisted Microreactor Enables Facile Integration of Trypsin Digestion, Hydrophilic Interaction Chromatography Enrichment, and On-Column Deglycosylation for Rapid and Sensitive N-Glycoproteome Analysis. Analytical Chemistry 2012, 84:5146-5153.
64Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res 2009, 8:651-661.
69Calvano CD, Zambonin CG, Jensen ON: Assessment of lectin and HILIC based enrichment protocols for characterization of serum glycoproteins by mass spectrometry. Journal of Proteomics 2008, 71:304-317.
71Hagglund P, Matthiesen R, Elortza F, Hojrup P, Roepstorff P, Jensen ON, Bunkenborg J: An enzymatic deglycosylation scheme enabling identification of core fucosylated N-glycans and O-glycosylation site mapping of human plasma proteins. Journal of Proteome Research 2007, 6:3021-3031.
81Liu T, Qian WJ, Gritsenko MA, Camp DG, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. Journal of Proteome Research 2005, 4:2070-2080.