Contains      

UniProtKB-P04233

Protein HLA class II histocompatibility antigen gamma chain
Gene CD74
Status Reviewed
Source Breast cancer xenografts; Breast cell lines; Breast tumor; Colorectal tumors; DLBCL cell lines (Diffuse large B-cell lymphoma); HepG2 cell line (Liver); Liver; Liver tumor (HCC); Lymphocytes; OVCAR-3 cell line (Ovarian cancer); Ovarian cancer cell lines; Ovarian tumor; Pancreatic islets; Prostate; Prostate tumor; Serum; Urine; XTC-1 Cell Line (Thyroid Cance); ovarian tumor
Years 2007-2015

Glycosites

Site Identified Peptides Year(Publication ID)
130 ALPQGPMQnATK 2015(unpublished);
130 GALPQGPMQnATK 2015(unpublished);
130 GALPQGPMQnATKY 2014(33);
130 ALPMGALPQGPMQnATK 2015(unpublished);
130 QALPMGALPQGPMQnATK 2015(unpublished);
130 MQALPMGALPQGPMQnATK 2014(14); 2015(unpublished);
130 LMQALPMGALPQGPMQnATK 2015(unpublished);
130 LMQALPMGALPQGPMQnATKY 2014(33);
130 ATPLLMQALPMGALPQGPMQnATK 2015(unpublished);
130 MATPIIMQAIPMGAIPQGPMQnATK 2014(16); 2014(32); 2014(32);
130 MATPLLMQALPMGALPQGPMQnATK 2007(68); 2009(54); 2011(52); 2012(34); 2013(33); 2014(unpublished);2015(unpublished);2007(unpublished);2007(unpublished);2007(unpublished);2007(unpublished);2007;2007;
136 GnMTEDHVMH 2014(33);
136 GnMTEDHVMHL 2014(33);
136 YGnMTEDHVMH 2014(14); 2015(unpublished);2015(unpublished);
136 GnMTEDHVMHLL 2014(33);
136 YGnMTEDHVMHL 2015(unpublished);
136 YGnMTEDHVMHLL 2014(33); 2015(unpublished);
136 YGnMTEDHVMHLLQNAD 2015(unpublished);
136 GnMTEDHVMHLLQNADPL 2014(33);
136 YGnMTEDHVMHIIQNADPIK 2014(32); 2014(32);
136 YGnMTEDHVMHLLQNADPLK 2007(62); 2009(64); 2009(48); 2012(52); 2012(34); 2013(38); 2013(45); 2013(33); 2014(1); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2007(unpublished);2007(unpublished);2007;2007;2007;2007;2007;
136 YGnMTEDHVMHIIQNADPIKVYPPIKGSFPENIR 2014(16);
256 CVFPnGTEVPNTR 2014(33);
256 CWCVFPnGTEVPNTR 2014(33);
256 GSIGYCWCVFPnGTEVPNTR 2014(33);
270 GHHnCSESLE 2014(33);
270 GHHnCSESLELEDPSSGLGVTK 2009(62); 2013(34); 2013(45); 2014(33); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);
270 SRGHHnCSESIEIEDPSSGIGVTK 2014(16);
270 SRGHHnCSESLELEDPSSGLGVTK 2013(38); 2014(33);

Sequence

1112131415161718191
MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKP
101111121131141151161171181191
PKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQ
201211221231241251261271281291
KPTDAPPKVLTKCQEEVSHIPAVHPGSFRPKCDENGNYLPLQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSESLELEDPSSGLGVTKQDLGPVPM

Reference

ID Publication
1Sun S, Shah P, Eshghi ST, Yang W, Trikannad N, Yang S, Chen L, Aiyetan P, Hoti N, Zhang Z, et al: Comprehensive analysis of protein glycosylation by solid-phase extraction of N-linked glycans and glycosite-containing peptides. Nat Biotech 2015, advance online publication.
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
16Deeb SJ, Cox J, Schmidt-Supprian M, Mann M: N-linked Glycosylation Enrichment for In-depth Cell Surface Proteomics of Diffuse Large B-cell Lymphoma Subtypes. Molecular & Cellular Proteomics 2014, 13:240-251.
32Zhang Z, Sun Z, Zhu J, Liu J, Huang G, Ye M, Zou H: High-Throughput Determination of the Site-Specific N-Sialoglycan Occupancy Rates by Differential Oxidation of Glycoproteins Followed with Quantitative Glycoproteomics Analysis. Analytical Chemistry 2014, 86:9830-9837.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
34Sun S, Zhang B, Aiyetan P, Zhou J-Y, Shah P, Yang W, Levine DA, Zhang Z, Chan DW, Zhang H: Analysis of N-glycoproteins using Genomic N-glycosite Prediction. Journal of Proteome Research 2013, 12:5609-5615.
38Kaji H, Ocho M, Togayachi A, Kuno A, Sogabe M, Ohkura T, Nozaki H, Angata T, Chiba Y, Ozaki H, et al: Glycoproteomic Discovery of Serological Biomarker Candidates for HCV/HBV Infection-Associated Liver Fibrosis and Hepatocellular Carcinoma. Journal of Proteome Research 2013, 12:2630-2640.
45Zhou H, Froehlich JW, Briscoe AC, Lee RS: The GlycoFilter: A Simple and Comprehensive Sample Preparation Platform for Proteomics, N-Glycomics and Glycosylation Site Assignment. Molecular & Cellular Proteomics 2013, 12:2981-2991.
48Danzer C, Eckhardt K, Schmidt A, Fankhauser N, Ribrioux S, Wollscheid B, Mueller L, Schiess R, Zuellig R, Lehmann R, et al: Comprehensive Description of the N-Glycoproteome of Mouse Pancreatic beta-Cells and Human Islets. Journal of Proteome Research 2012, 11:1598-1608.
52Yen T-Y, Macher BA, McDonald CA, Alleyne-Chin C, Timpe LC: Glycoprotein Profiles of Human Breast Cells Demonstrate a Clear Clustering of Normal/Benign versus Malignant Cell Lines and Basal versus Luminal Cell Lines. Journal of Proteome Research 2012, 11:656-667.
54Tian Y, Yao Z, Roden R, Zhang H: Identification of glycoproteins associated with different histological subtypes of ovarian tumors using quantitative glycoproteomics. Proteomics 2011, 11:4677-4687.
62Arcinas A, Yen T-Y, Kebebew E, Macher BA: Cell Surface and Secreted Protein Profiles of Human Thyroid Cancer Cell Lines Reveal Distinct Glycoprotein Patterns. Journal of Proteome Research 2009, 8:3958-3968.
64Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res 2009, 8:651-661.
68Zhang L, Xu Y, Yao H, Xie L, Yao J, Lu H, Yang P: Boronic Acid Functionalized Core-Satellite Composite Nanoparticles for Advanced Enrichment of Glycopeptides and Glycoproteins. Chemistry-a European Journal 2009, 15:10158-10166.