Contains      

UniProtKB-P05026

Protein Sodium/potassium-transporting ATPase subunit beta-1
Gene ATP1B1
Status Reviewed
Source 22Rv1 cell line (prostate cancer); ARO Cell Line (Thyroid Cance); Breast Cancer cell lines; Breast cancer cell lines; Breast cancer xenografts; Breast cell lines; Breast tumor; Colorectal cancer cell line, HCT-116 (colorectal cancer); Colorectal tumor; DLBCL cell lines (Diffuse large B-cell lymphoma); DRO-1 Cell Line (Thyroid Cance); HEK293 cell line (embryonic kidney); HEK293T cell line (embryonic kidney), HEK293T cell line (embryonic kidney); HeLa cell line (Cervical cancer); Hela cell line (cervical cancer); HepG2 cell line (Liver); HuH-7 cell line (Liver); IGROV-1/CP cell line (Ovarian cancer)IGROV-1/CP; LNCap/PC3 cell lines (Prostate cancer); Liver; Liver tumor (HCC); LnCap cell line (Prostate cancer); Lymphocytes; OVCAR-3 cell line (Ovarian cancer); Ovarian cancer cell lines; Ovarian tumor; Pancreatic islets; Prostate; Prostate cancer cell lines; Prostate cancer metastasis to liver; Prostate tumor; SKOV-3 cell line (Ovarian cancer)Jurkat T cell line; Spermatozoa; TPC-1 Cell Line (Thyroid Cance); Urine; XTC-1 Cell Line (Thyroid Cance); prostate cancer cell lines
Years 2003-2015

Glycosites

Site Identified Peptides Year(Publication ID)
158 LEWLGnCS 2014(33);
158 WLGnCSGL 2014(33);
158 EWLGnCSGL 2009(64);
158 FKLEWLGnCS 2014(33);
158 KLEWLGnCSGL 2009(64); 2014(33);
158 WLGnCSGLNDE 2014(33);
158 LGnCSGLNDETY 2014(33);
158 KIEWIGnCSGIND 2013(37);
158 LEWLGnCSGLNDE 2014(33);
158 nCSGLNDETYGYK 2015(1);
158 WLGnCSGLNDETY 2014(33);
158 EWLGnCSGLNDETY 2014(33);
158 KLEWLGnCSGLNDE 2014(33);
158 FKLEWLGnCSGLNDE 2014(33);
158 LEWLGnCSGLNDETY 2012(48); 2014(33);
158 LGnCSGLNDETYGYK 2012(48);
158 KLEWLGnCSGLNDETY 2014(33);
158 WLGnCSGLNDETYGYK 2014(33);
158 FKLEWLGnCSGLNDETY 2012(48); 2014(33);
158 WLGnCSGLNDETYGYKE 2014(33);
158 IEWIGnCSGINDETYGYK 2014(32); 2014(32);
158 LEWLGnCSGLNDETYGYK 2007(72); 2009(62); 2009(64); 2011(58); 2012(48); 2012(52); 2013(38); 2014(22); 2014(33); 2015(1); 2015(2); 2015(9); 2015(12); 2015(unpublished);2015(unpublished);2007(unpublished);2007(unpublished);2007;2007;
158 KLEWLGnCSGLNDETYGYK 2014(33);
158 FKIEWIGnCSGINDETYGYK 2013(43); 2014(16);
158 FKLEWLGnCSGLNDETYGYK 2003(83); 2007(75); 2009(62); 2009(62); 2009(64); 2011(58); 2012(48); 2012(52); 2014(15); 2014(33); 2015(unpublished);2015(1); 2015(2); 2015(unpublished);2015(unpublished);2015(unpublished);2015(12);
158 FKLEWLGnCSGLNDETYGYKEGKPCIIIK 2011(58);
193 PKPPKnESLE 2014(33);
193 nESLETYPVMK 2014(22); 2014(33); 2015(unpublished);2015(1); 2015(unpublished);
193 VLGFKPKPPKnE 2014(33);
193 PKnESLETYPVMK 2012(48);
193 PPKnESLETYPVMK 2012(48); 2014(33);
193 GFKPKPPKnESLETY 2014(33);
193 PKPPKnESLETYPVM 2012(48);
193 VLGFKPKPPKnESLE 2014(33);
193 NRVLGFKPKPPKnESL 2009(64);
193 PKPPKnESIETYPVMK 2013(43);
193 PKPPKnESLETYPVMK 2007(75); 2012(48); 2013(38); 2013(38); 2014(33); 2015(unpublished);
193 KPKPPKnESLETYPVMKY 2014(33);
193 GFKPKPPKnESLETYPVMK 2012(48);
193 GFKPKPPKnESLETYPVMKY 2014(33);
193 LGFKPKPPKnESLETYPVMK 2012(48);
193 VLGFKPKPPKnESLETYPVM 2012(48);
193 VLGFKPKPPKnESLETYPVMK 2003( 83); 2007(75); 2007(64); 2009(58); 2011(48); 2012(52); 2012(34); 2013(34); 2013(13); 2014(14); 2014(33); 2014(1); 2015(2); 2015(12); 2015(unpublished);2015(unpublished);2015(unpublished);2007(unpublished);2007(unpublished);2007(unpublished);2007;2007;2007;
193 LNRVLGFKPKPPKnESLETYPVMK 2011(58);
265 LAVQFTnL 2014(33);
265 FTnLTMDTE 2014(33);
265 nLTMDTEIR 2014(14); 2015(1); 2015(unpublished);
265 QFTnLTMDTE 2014(33);
265 TnLTMDTEIR 2007(75); 2014(33);
265 FTnLTMDTEIR 2012(3); 2012(48); 2014(14); 2014(33); 2015(unpublished);2015(unpublished);
265 VQFTnLTMDTE 2014(33);
265 QFTnLTMDTEIR 2014(14); 2014(33); 2015(unpublished);
265 FTnLTMDTEIRIE 2014(33);
265 LAVQFTnLTMDTE 2014(33);
265 TnLTMDTEIRIEC 2014(33);
265 VQFTnLTMDTEIR 2012(48); 2014(33);
265 YLQPLLAVQFTnL 2012(48);
265 AVQFTnLTMDTEIR 2007(75); 2014(14); 2014(33);
265 TnLTMDTEIRIECK 2014(33);
265 LAVQFTnLTMDTEIR 2007(75); 2012(48); 2014(14); 2014(33); 2015(unpublished);
265 TnLTMDTEIRIECKAY 2014(33);
265 PLLAVQFTnLTMDTEIR 2007(75);
265 YLQPLLAVQFTnLTMDTE 2014(33);
265 YIQPIIAVQFTnITMDTEIR 2014(16); 2014(32); 2014(32);
265 YLQPLLAVQFTnLTMDTEIR 2003( 83); 2007(72); 2007(75); 2007(62); 2009(62); 2009(62); 2009(62); 2009(64); 2009(67); 2009(58); 2011(50); 2012(52); 2012(34); 2013(14); 2014(33); 2014(1); 2015(2); 2015(12); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2007(unpublished);2007(unpublished);2007(Unpublished ); 2007;2007;2007;2007;2007;2007 ;
265 YLQPLLAVQFTnLTMDTEIRIECK 2012(52);
265 PYYGKLLQPKYLQPLLAVQFTnLTMDTEIR 2007(75);

Sequence

1112131415161718191
MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISEFKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEA
101111121131141151161171181191
YVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYP
201211221231241251261271281291
VMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIE
301
VKS

Reference

ID Publication
1Sun S, Shah P, Eshghi ST, Yang W, Trikannad N, Yang S, Chen L, Aiyetan P, Hoti N, Zhang Z, et al: Comprehensive analysis of protein glycosylation by solid-phase extraction of N-linked glycans and glycosite-containing peptides. Nat Biotech 2015, advance online publication.
2Shah P, Wang X, Yang W, Eshghi ST, Sun S, Hoti N, Chen L, Yang S, Pasay J, Rubin A: Integrated Proteomic and Glycoproteomic Analyses of Prostate Cancer Cells Reveal Glycoprotein Alteration in Protein Abundance and Glycosylation. Molecular & Cellular Proteomics 2015, 14:2753-2763.
3Tian Y, Almaraz RT, Choi CH, Li QK, Saeui C, Li D, Shah P, Bhattacharya R, Yarema KJ, Zhang H: Identification of sialylated glycoproteins from metabolically oligosaccharide engineered pancreatic cells. Clinical proteomics 2015, 12:11.
9Smeekens JM, Chen WX, Wu RH: Mass Spectrometric Analysis of the Cell Surface N-Glycoproteome by Combining Metabolic Labeling and Click Chemistry. Journal of the American Society for Mass Spectrometry 2015, 26:604-614.
12Weng Y, Sui Z, Jiang H, Shan Y, Chen L, Zhang S, Zhang L, Zhang Y: Releasing N-glycan from Peptide N-terminus by N-terminal Succinylation Assisted Enzymatic Deglycosylation. Scientific Reports 2015, 5.
13Yang W, Laeyendecker O, Wendel SK, Zhang B, Sun S, Zhou J-Y, Ao M, Moore RD, Jackson JB, Zhang H: Glycoproteomic Study Reveals Altered Plasma Proteins Associated with HIV Elite Suppressors. Theranostics 2014, 4:1153.
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
15Chen R, Seebun D, Ye M, Zou H, Figeys D: Site-specific characterization of cell membrane N-glycosylation with integrated hydrophilic interaction chromatography solid phase extraction and LC-MS/MS. Journal of Proteomics 2014, 103:194-203.
16Deeb SJ, Cox J, Schmidt-Supprian M, Mann M: N-linked Glycosylation Enrichment for In-depth Cell Surface Proteomics of Diffuse Large B-cell Lymphoma Subtypes. Molecular & Cellular Proteomics 2014, 13:240-251.
22Nicastri A, Gaspari M, Sacco R, Elia L, Gabriele C, Romano R, Rizzuto A, Cuda G: N-Glycoprotein Analysis Discovers New Up-Regulated Glycoproteins in Colorectal Cancer Tissue. Journal of Proteome Research 2014, 13:4932-4941.
32Zhang Z, Sun Z, Zhu J, Liu J, Huang G, Ye M, Zou H: High-Throughput Determination of the Site-Specific N-Sialoglycan Occupancy Rates by Differential Oxidation of Glycoproteins Followed with Quantitative Glycoproteomics Analysis. Analytical Chemistry 2014, 86:9830-9837.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
34Sun S, Zhang B, Aiyetan P, Zhou J-Y, Shah P, Yang W, Levine DA, Zhang Z, Chan DW, Zhang H: Analysis of N-glycoproteins using Genomic N-glycosite Prediction. Journal of Proteome Research 2013, 12:5609-5615.
37Boersema PJ, Geiger T, Wisniewski JR, Mann M: Quantification of the N-glycosylated Secretome by Super-SILAC During Breast Cancer Progression and in Human Blood Samples. Molecular & Cellular Proteomics 2013, 12:158-171.
38Kaji H, Ocho M, Togayachi A, Kuno A, Sogabe M, Ohkura T, Nozaki H, Angata T, Chiba Y, Ozaki H, et al: Glycoproteomic Discovery of Serological Biomarker Candidates for HCV/HBV Infection-Associated Liver Fibrosis and Hepatocellular Carcinoma. Journal of Proteome Research 2013, 12:2630-2640.
43Wang GG, Wu YB, Zhou T, Guo YS, Zheng B, Wang J, Bi Y, Liu FJ, Zhou ZM, Guo XJ, Sha JH: Mapping of the N-Linked Glycoproteome of Human Spermatozoa. Journal of Proteome Research 2013, 12:5750-5759.
48Danzer C, Eckhardt K, Schmidt A, Fankhauser N, Ribrioux S, Wollscheid B, Mueller L, Schiess R, Zuellig R, Lehmann R, et al: Comprehensive Description of the N-Glycoproteome of Mouse Pancreatic beta-Cells and Human Islets. Journal of Proteome Research 2012, 11:1598-1608.
50Whitmore TE, Peterson A, Holzman T, Eastham A, Amon L, McIntosh M, Ozinsky A, Nelson PS, Martin DB: Integrative Analysis of N-Linked Human Glycoproteomic Data Sets Reveals PTPRF Ectodomain as a Novel Plasma Biomarker Candidate for Prostate Cancer. Journal of Proteome Research 2012, 11:2653-2665.
52Yen T-Y, Macher BA, McDonald CA, Alleyne-Chin C, Timpe LC: Glycoprotein Profiles of Human Breast Cells Demonstrate a Clear Clustering of Normal/Benign versus Malignant Cell Lines and Basal versus Luminal Cell Lines. Journal of Proteome Research 2012, 11:656-667.
58Nagano K, Shinkawa T, Kato K, Inomata N, Yabuki N, Haramura M: Distinct cell surface proteome profiling by biotin labeling and glycoprotein capturing. Journal of Proteomics 2011, 74:1985-1993.
62Arcinas A, Yen T-Y, Kebebew E, Macher BA: Cell Surface and Secreted Protein Profiles of Human Thyroid Cancer Cell Lines Reveal Distinct Glycoprotein Patterns. Journal of Proteome Research 2009, 8:3958-3968.
64Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res 2009, 8:651-661.
67McDonald CA, Yang JY, Marathe V, Yen T-Y, Macher BA: Combining Results from Lectin Affinity Chromatography and Glycocapture Approaches Substantially Improves the Coverage of the Glycoproteome. Molecular & Cellular Proteomics 2009, 8:287-301.
72Hanson SR, Hsu T-L, Weerapana E, Kishikawa K, Simon GM, Cravatt BF, Wong C-H: Tailored glycoproteomics and glycan site mapping using saccharide-selective bioorthogonal probes. Journal of the American Chemical Society 2007, 129:7266-+.
75Sun B, Ranish JA, Utleg AG, White JT, Yan X, Lin B, Hood L: Shotgun glycopeptide capture approach coupled with mass Spectrometry for comprehensive glycoproteomics. Molecular & Cellular Proteomics 2007, 6:141-149.
83Zhang H, Li XJ, Martin DB, Aebersold R: Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry. Nature Biotechnology 2003, 21:660-666.