Contains      

UniProtKB-P05164

Protein Myeloperoxidase
Gene MPO
Status Reviewed
Source Bladder tumor; Breast Cancer cell lines; Breast cancer xenografts; Colorectal tumor; Colorectal tumors; Liver; Liver tumor (HCC); Lung Adenocarcinoma; Lung tumor; Ovarian tumor; Ovarian tumorPBMC Macrophage cells; PBMC Macrophage cells; Plasma; Platelet; Prostate; Prostate cancer metastasis to liver; Prostate tumor; Saliva; Serum; Spermatozoa; Urine; lung; ovarian tumor
Years 2005-20072007

Glycosites

Site Identified Peptides Year(Publication ID)
139 RPFnVTDV 2014(14); 2015(unpublished);
139 RPFnVTDVLTPAQLNVLSK 2005( 81); 2014(33); 2007(unpublished);2007(unpublished);
323 nITIR 2014(33);
323 nITLR 2014(33);
323 nLTIR 2014(33);
323 nLTLR 2014(33);
323 SnITIR 2014(33);
323 PGSnITIR 2014(14);
323 PACPGSnITIR 2014(14);
323 SCPACPGSnITIR 2006( 77); 2011(54); 2013(39); 2014(14); 2014(36); 2014(22); 2014(32); 2014(32); 2014(33); 2015(unpublished);2015(unpublished);2015;2015;2015;2015;2007;2007;
355 nMSNQLGLL 2014(33);
355 nMSNQLGLLAV 2007(73); 2014(14); 2015(unpublished);
355 NLRnMSNQLGLL 2014(33);
355 ARNLRnMSNQLGLL 2014(33);
355 NLRnMSNQLGLLAV 2014(14); 2015(unpublished);
355 nMSNQIGIIAVNQR 2013(43);
355 nMSNQLGLLAVNQR 2007(64); 2009(54); 2011(49); 2012(39); 2013(45); 2013(14); 2014(36); 2014(22); 2014(33); 2014(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(UnpublishedUnpublished ); 2015;2015;2007;2007;2007;2007;20072007 ;
355 NLRnMSNQLGLLAVNQR 2009(68); 2013(45); 2014(19); 2014(33); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);
391 PCLLTnR 2014(33);
391 DPCLLTnR 2014(14); 2014(33);
391 DDPCLLTnR 2014(33);
391 TnRSARIPC 2014(33);
391 HDDPCLLTnR 2014(14); 2014(33);
391 LHDDPCLLTnR 2014(33);
391 NLHDDPCLLTnR 2014(33);
391 DNLHDDPCLLTnR 2014(14); 2014(33);
391 DPCIITnRSARIP 2013(37);
391 AIIPFDNIHDDPCIITnR 2013(43);
391 ALLPFDNLHDDPCLLTnR 2007(73); 2007(64); 2009(34); 2013(13); 2014(14); 2014(19); 2014(33); 2014(unpublished);2015(unpublished);2015(unpublished);2015(UnpublishedUnpublished ); 2015;2015;2015;2007;2007;2007;20072007 ;
391 GRALLPFDNLHDDPCLLTnR 2014(33);
391 FQDNGRALLPFDNLHDDPCLLTnR 2014(33);
483 YnDSVDPR 2014(33);
483 SYnDSVDPR 2005(81); 2006(77); 2011(56); 2013(39); 2014(14); 2014(22); 2014(33); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(8); 2015(10);
483 RSYnDSVDPR 2014(33);
483 nDSVDPRIANVF 2014(33);
483 PTYRSYnDSVDPR 2013(37);
483 RSYnDSVDPRIAN 2014(33);
483 RSYnDSVDPRIANVF 2014(33);
729 DFVnCSTLPA 2014(14); 2015(unpublished);
729 DFVnCSTLPAL 2014(33);
729 DFVnCSTLPALN 2014(33);
729 DFVnCSTLPALNL 2014(14); 2014(33); 2015(unpublished);
729 DFVnCSTLPALNLA 2007(73); 2014(14); 2014(33); 2015(unpublished);
729 DFVnCSTIPAINIASWR 2014(32);
729 DFVnCSTLPALNLASWR 2007(45); 2013(33); 2014(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(Unpublished ); 2007;2007;2007;2007;2007 ;

Sequence

1112131415161718191
MGVPFFSSLRCMVDLGPCWAGGLTAEMKLLLALAGLLAILATPQPSEGAAPAVLGEVDTSLVLSSMEEAKQLVDKAYKERRESIKQRLRSGSASPMELLS
101111121131141151161171181191
YFKQPVAATRTAVRAADYLHVALDLLERKLRSLWRRPFNVTDVLTPAQLNVLSKSSGCAYQDVGVTCPEQDKYRTITGMCNNRRSPTLGASNRAFVRWLP
201211221231241251261271281291
AEYEDGFSLPYGWTPGVKRNGFPVALARAVSNEIVRFPTDQLTPDQERSLMFMQWGQLLDHDLDFTPEPAARASFVTGVNCETSCVQQPPCFPLKIPPND
301311321331341351361371381391
PRIKNQADCIPFFRSCPACPGSNITIRNQINALTSFVDASMVYGSEEPLARNLRNMSNQLGLLAVNQRFQDNGRALLPFDNLHDDPCLLTNRSARIPCFL
401411421431441451461471481491
AGDTRSSEMPELTSMHTLLLREHNRLATELKSLNPRWDGERLYQEARKIVGAMVQIITYRDYLPLVLGPTAMRKYLPTYRSYNDSVDPRIANVFTNAFRY
501511521531541551561571581591
GHTLIQPFMFRLDNRYQPMEPNPRVPLSRVFFASWRVVLEGGIDPILRGLMATPAKLNRQNQIAVDEIRERLFEQVMRIGLDLPALNMQRSRDHGLPGYN
601611621631641651661671681691
AWRRFCGLPQPETVGQLGTVLRNLKLARKLMEQYGTPNNIDIWMGGVSEPLKRKGRVGPLLACIIGTQFRKLRDGDRFWWENEGVFSMQQRQALAQISLP
701711721731741
RIICDNTGITTVSKNNIFMSNSYPRDFVNCSTLPALNLASWREAS

Reference

ID Publication
8Ma C, Zhang Q, Qu JY, Zhao XY, Li X, Liu YP, Wang PG: A precise approach in large scale core-fucosylated glycoprotein identification with low- and high-normalized collision energy. Journal of Proteomics 2015, 114:61-70.
10Tan ZJ, Yin HD, Nie S, Lin ZX, Zhu JH, Ruffin MT, Anderson MA, Simone DM, Lubman DM: Large-Scale Identification of Core-Fucosylated Glycopeptide Sites in Pancreatic Cancer Serum Using Mass Spectrometry. Journal of Proteome Research 2015, 14:1968-1978.
13Yang W, Laeyendecker O, Wendel SK, Zhang B, Sun S, Zhou J-Y, Ao M, Moore RD, Jackson JB, Zhang H: Glycoproteomic Study Reveals Altered Plasma Proteins Associated with HIV Elite Suppressors. Theranostics 2014, 4:1153.
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
19Huang G, Sun Z, Qin H, Zhao L, Xiong Z, Peng X, Ou J, Zou H: Preparation of hydrazine functionalized polymer brushes hybrid magnetic nanoparticles for highly specific enrichment of glycopeptides. Analyst 2014, 139:2199-2206.
22Nicastri A, Gaspari M, Sacco R, Elia L, Gabriele C, Romano R, Rizzuto A, Cuda G: N-Glycoprotein Analysis Discovers New Up-Regulated Glycoproteins in Colorectal Cancer Tissue. Journal of Proteome Research 2014, 13:4932-4941.
32Zhang Z, Sun Z, Zhu J, Liu J, Huang G, Ye M, Zou H: High-Throughput Determination of the Site-Specific N-Sialoglycan Occupancy Rates by Differential Oxidation of Glycoproteins Followed with Quantitative Glycoproteomics Analysis. Analytical Chemistry 2014, 86:9830-9837.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
34Sun S, Zhang B, Aiyetan P, Zhou J-Y, Shah P, Yang W, Levine DA, Zhang Z, Chan DW, Zhang H: Analysis of N-glycoproteins using Genomic N-glycosite Prediction. Journal of Proteome Research 2013, 12:5609-5615.
36Li QK, Shah P, Li Y, Aiyetan PO, Chen J, Yung R, Molena D, Gabrielson E, Askin F, Chan DW: Glycoproteomic analysis of bronchoalveolar lavage (BAL) fluid identifies tumor-associated glycoproteins from lung adenocarcinoma. Journal of proteome research 2013, 12:3689-3696.
37Boersema PJ, Geiger T, Wisniewski JR, Mann M: Quantification of the N-glycosylated Secretome by Super-SILAC During Breast Cancer Progression and in Human Blood Samples. Molecular & Cellular Proteomics 2013, 12:158-171.
39Li QK, Shah P, Li Y, Aiyetan PO, Chen J, Yung R, Molena D, Gabrielson E, Askin F, Chan DW, Zhang H: Glycoproteomic Analysis of Bronchoalveolar Lavage (BAL) Fluid Identifies Tumor-Associated Glycoproteins from Lung Adenocarcinonna. Journal of Proteome Research 2013, 12:3689-3696.
43Wang GG, Wu YB, Zhou T, Guo YS, Zheng B, Wang J, Bi Y, Liu FJ, Zhou ZM, Guo XJ, Sha JH: Mapping of the N-Linked Glycoproteome of Human Spermatozoa. Journal of Proteome Research 2013, 12:5750-5759.
45Zhou H, Froehlich JW, Briscoe AC, Lee RS: The GlycoFilter: A Simple and Comprehensive Sample Preparation Platform for Proteomics, N-Glycomics and Glycosylation Site Assignment. Molecular & Cellular Proteomics 2013, 12:2981-2991.
49Kim JY, Kim S-K, Kang D, Moon MH: Dual Lectin-Based Size Sorting Strategy to Enrich Targeted N-Glycopeptides by Asymmetrical Flow Field-Flow Fractionation: Profiling Lung Cancer Biomarkers. Analytical Chemistry 2012, 84:5343-5350.
54Tian Y, Yao Z, Roden R, Zhang H: Identification of glycoproteins associated with different histological subtypes of ovarian tumors using quantitative glycoproteomics. Proteomics 2011, 11:4677-4687.
56Bandhakavi S, Van Riper SK, Tawfik PN, Stone MD, Haddad T, Rhodus NL, Carlis JV, Griffin TJ: Hexapeptide Libraries for Enhanced Protein PTM Identification and Relative Abundance Profiling in Whole Human Saliva. Journal of Proteome Research 2011, 10:1052-1061.
64Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res 2009, 8:651-661.
68Zhang L, Xu Y, Yao H, Xie L, Yao J, Lu H, Yang P: Boronic Acid Functionalized Core-Satellite Composite Nanoparticles for Advanced Enrichment of Glycopeptides and Glycoproteins. Chemistry-a European Journal 2009, 15:10158-10166.
73Larsen MR, Jensen SS, Jakobsen LA, Heegaard NHH: Exploring the sialiome using titanium dioxide chromatography and mass spectrometry. Molecular & Cellular Proteomics 2007, 6:1778-1787.
77Ramachandran P, Boontheung P, Xie YM, Sondej M, Wong DT, Loo JA: Identification of N-linked glycoproteins in human saliva by glycoprotein capture and mass spectrometry. Journal of Proteome Research 2006, 5:1493-1503.
81Liu T, Qian WJ, Gritsenko MA, Camp DG, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. Journal of Proteome Research 2005, 4:2070-2080.