Contains      

UniProtKB-P05362

Protein Intercellular adhesion molecule 1
Gene ICAM1
Status Reviewed
Source ARO Cell Line (Thyroid Cance); Breast Cancer cell lines; Breast cancer cell lines; Breast cancer xenografts; Breast cancer xenograftsPBMC Macrophage cells; Breast cell lines; Breast tumor; Colorectal cancer cell line, HCT-116 (colorectal cancer); Colorectal tumor; DLBCL cell lines (Diffuse large B-cell lymphoma); DRO-1 Cell Line (Thyroid Cance); HCC cell lines (Liver); HCCLM3 cell line (Liver); HeLa cell line (Cervical cancer); Hela cell line (cervical cancer); HepG2 cell line (Liver); HuH-7 cell line (Liver); Human; K562A cell line (Leukemia); K562S cell line (Leukemia); LNCap/PC3 cell lines (Prostate cancer); Liver; Liver tumor (HCC); Lymphocytes; Non-small Cell Lung Carcinoma; OVCAR-3 cell line (Ovarian cancer); Ovarian tumor; PBMC Macrophage cells; Pancreatic islets; Plasma; PlasmaJurkat T cell line; Prostate; Prostate cancer metastasis to liver; Prostate tumor; SW1990 cell line (Pancreatic cancer); Serum; Serum (Colorectal cancer); Serum (HCC); TPC-1 Cell Line (Thyroid Cance); Urine; XTC-1 Cell Line (Thyroid Cance); ovarian tumor; plasma; prostate cancer cell lines
Years 2005-2015

Glycosites

Site Identified Peptides Year(Publication ID)
130 nITIR 2014(33);
130 nITLR 2014(33);
130 nLTIR 2014(33);
130 nLTLR 2014(33);
130 APLPSWQPVGKnL 2014(33);
130 VEIAPIPSWQPVGKnITIR 2014(16);
130 VELAPLPSWQPVGKnLTLR 2009(62);
145 AnITVVIIR 2014(32);
145 AnLTVVLLR 2005( 81); 2007(72); 2007(62); 2009(62); 2009(62); 2009(62); 2009(63); 2009(66); 2009(67); 2009(40); 2010(58); 2011(52); 2012(34); 2013(40); 2013(42); 2013(45); 2013(45); 2013(13); 2014(13); 2014(14); 2014(19); 2014(22); 2014(23); 2014(25); 2014(25); 2014(33); 2014(1); 2015(2); 2015(4); 2015(8); 2015(10); 2015(12); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015;2015;2015;2015;2007;2007;2007;2007;
145 AnITVVIIRGEK 2014(16);
145 AnLTVVLLRGEK 2011(58); 2014(33); 2015(2); 2015(unpublished);
145 AnLTVVLLRGEKE 2014(33);
145 GGAPRAnITVVII 2013(37);
145 CQVEGGAPRAnLTVVLLRGEK 2013(38);
183 DHHGAnF 2014(33);
183 DHHGAnFSC 2012(48);
183 DHHGAnFSCR 2007(48); 2012(52); 2012(34); 2013(40); 2013(13); 2014(14); 2014(22); 2014(33); 2014(unpublished);2015(unpublished);2015;2015;2015;2015;2015;2007;2007;
183 RDHHGAnFSCR 2014(16); 2015(12);
183 RDHHGAnFSCRTE 2013(37);
202 LFEnTSAPY 2014(33);
202 LFEnTSAPYQ 2009(64);
202 LFEnTSAPYQLQ 2014(33);
202 LFEnTSAPYQLQTF 2014(33);
202 DLRPQGLELFEnTSAPY 2014(33);
202 TELDLRPQGLELFEnTSAPY 2014(33); 2007(unpublished);2007(unpublished);2007(unpublished);2007(unpublished);
202 TELDLRPQGLELFEnTSAPYQLQTF 2014(33);
202 LFEnTSAPYQLQTFVLPATPPQLVSPR 2014(33);
202 TELDLRPQGLELFEnTSAPYQLQTFVLPATPPQLVSPR 2005(81); 2009(62); 2012(52); 2013(40); 2014(13); 2014(33); 2015(unpublished);2015(2); 2015(unpublished);
267 LNPTVTYGnDSF 2014(33);
267 PTVTYGnDSFSAK 2012(48); 2013(37); 2014(33); 2015(unpublished);
267 INPTVTYGnDSFSAK 2014(16); 2014(32); 2014(32);
267 LNPTVTYGnDSFSAK 2005( 81); 2007(72); 2007(62); 2009(62); 2009(62); 2009(62); 2009(63); 2009(64); 2009(67); 2009(40); 2010(54); 2011(58); 2011(48); 2012(52); 2012(34); 2013(38); 2013(38); 2013(38); 2013(38); 2013(40); 2013(42); 2013(45); 2013(13); 2014(13); 2014(14); 2014(17); 2014(18); 2014(21); 2014(22); 2014(25); 2014(25); 2014(33); 2014(1); 2015(2); 2015(3); 2015(4); 2015(8); 2015(12); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(Unpublished ); 2015;2007;2007;2007;2007;2007;2007;2007;2007 ;
267 QRLNPTVTYGnDSFSAKASV 2015(6);
296 LTCAVILGnQSQE 2014(33);
296 GTQRLTCAVILGnQSQE 2013(42);
385 IHKnQTREL 2014(33);
385 VAGQLIHKnQTR 2014(33);
385 VAGQLIHKnQTRE 2014(33);
385 SFSCSATIEVAGQIIHKnQTR 2014(16);
385 SFSCSATLEVAGQLIHKnQTR 2009(62); 2011(58); 2014(33); 2015(unpublished);
406 DCPGnWTWPE 2014(33);
406 RDCPGnWTWPE 2014(33);
406 GPRLDERDCPGnW 2014(33);
406 DCPGnWTWPENSQQTPM 2014(33); 2015(unpublished);
406 DCPGnWTWPENSQQTPMCQAWGNPIPEIK 2014(16); 2014(32); 2014(32);
406 DCPGnWTWPENSQQTPMCQAWGNPLPELK 2012(52); 2014(33);
406 LDERDCPGnWTWPENSQQTPMCQAWGNPLPELK 2009(62); 2011(58); 2012(52);
406 VLYGPRLDERDCPGnWTWPENSQQTPMCQAWGNPLPELK 2013(38);

Sequence

1112131415161718191
MAPSSPRPALPALLVLLGALFPGPGNAQTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQ
101111121131141151161171181191
STAKTFLTVYWTPERVELAPLPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHHGANFSCRTELDLRPQGLELF
201211221231241251261271281291
ENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQE
301311321331341351361371381391
TLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDE
401411421431441451461471481491
RDCPGNWTWPENSQQTPMCQAWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYEIVIITVVAAAVIMGTAGLST
501511521531
YLYNRQRKIKKYRLQQAQKGTPMKPNTQATPP

Reference

ID Publication
1Sun S, Shah P, Eshghi ST, Yang W, Trikannad N, Yang S, Chen L, Aiyetan P, Hoti N, Zhang Z, et al: Comprehensive analysis of protein glycosylation by solid-phase extraction of N-linked glycans and glycosite-containing peptides. Nat Biotech 2015, advance online publication.
2Shah P, Wang X, Yang W, Eshghi ST, Sun S, Hoti N, Chen L, Yang S, Pasay J, Rubin A: Integrated Proteomic and Glycoproteomic Analyses of Prostate Cancer Cells Reveal Glycoprotein Alteration in Protein Abundance and Glycosylation. Molecular & Cellular Proteomics 2015, 14:2753-2763.
3Tian Y, Almaraz RT, Choi CH, Li QK, Saeui C, Li D, Shah P, Bhattacharya R, Yarema KJ, Zhang H: Identification of sialylated glycoproteins from metabolically oligosaccharide engineered pancreatic cells. Clinical proteomics 2015, 12:11.
4Cheow ESH, Sim KH, de Kleijn D, Lee CN, Sorokin V, Sze SK: Simultaneous Enrichment of Plasma Soluble and Extracellular Vesicular Glycoproteins Using Prolonged Ultracentrifugation-Electrostatic Repulsion-hydrophilic Interaction Chromatography (PUC-ERLIC) Approach. Molecular & Cellular Proteomics 2015, 14:1657-1671.
6Kim DS, Hahn Y: The acquisition of novel N-glycosylation sites in conserved proteins during human evolution. Bmc Bioinformatics 2015, 16.
8Ma C, Zhang Q, Qu JY, Zhao XY, Li X, Liu YP, Wang PG: A precise approach in large scale core-fucosylated glycoprotein identification with low- and high-normalized collision energy. Journal of Proteomics 2015, 114:61-70.
10Tan ZJ, Yin HD, Nie S, Lin ZX, Zhu JH, Ruffin MT, Anderson MA, Simone DM, Lubman DM: Large-Scale Identification of Core-Fucosylated Glycopeptide Sites in Pancreatic Cancer Serum Using Mass Spectrometry. Journal of Proteome Research 2015, 14:1968-1978.
12Weng Y, Sui Z, Jiang H, Shan Y, Chen L, Zhang S, Zhang L, Zhang Y: Releasing N-glycan from Peptide N-terminus by N-terminal Succinylation Assisted Enzymatic Deglycosylation. Scientific Reports 2015, 5.
13Yang W, Laeyendecker O, Wendel SK, Zhang B, Sun S, Zhou J-Y, Ao M, Moore RD, Jackson JB, Zhang H: Glycoproteomic Study Reveals Altered Plasma Proteins Associated with HIV Elite Suppressors. Theranostics 2014, 4:1153.
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
16Deeb SJ, Cox J, Schmidt-Supprian M, Mann M: N-linked Glycosylation Enrichment for In-depth Cell Surface Proteomics of Diffuse Large B-cell Lymphoma Subtypes. Molecular & Cellular Proteomics 2014, 13:240-251.
17Fang C, Xiong Z, Qin H, Huang G, Liu J, Ye M, Feng S, Zou H: One-pot synthesis of magnetic colloidal nanocrystal clusters coated with chitosan for selective enrichment of glycopeptides. Analytica Chimica Acta 2014, 841:99-105.
18Hirao Y, Matsuzaki H, Iwaki J, Kuno A, Kaji H, Ohkura T, Togayachi A, Abe M, Nomura M, Noguchi M, et al: Glycoproteomics Approach for Identifying Glycobiomarker Candidate Molecules for Tissue Type Classification of Non-small Cell Lung Carcinoma. Journal of Proteome Research 2014, 13:4705-4716.
19Huang G, Sun Z, Qin H, Zhao L, Xiong Z, Peng X, Ou J, Zou H: Preparation of hydrazine functionalized polymer brushes hybrid magnetic nanoparticles for highly specific enrichment of glycopeptides. Analyst 2014, 139:2199-2206.
21Liu L, Yu M, Zhang Y, Wang C, Lu H: Hydrazide Functionalized Core-Shell Magnetic Nanocomposites for Highly Specific Enrichment of N-Glycopeptides. Acs Applied Materials & Interfaces 2014, 6:7823-7832.
22Nicastri A, Gaspari M, Sacco R, Elia L, Gabriele C, Romano R, Rizzuto A, Cuda G: N-Glycoprotein Analysis Discovers New Up-Regulated Glycoproteins in Colorectal Cancer Tissue. Journal of Proteome Research 2014, 13:4932-4941.
23Pan C, Zhou Y, Dator R, Ginghina C, Zhao Y, Movius J, Peskind E, Zabetian CP, Quinn J, Galasko D, et al: Targeted Discovery and Validation of Plasma Biomarkers of Parkinson's Disease. Journal of Proteome Research 2014, 13:4535-4545.
25Sun Z, Dong J, Zhang S, Hu Z, Cheng K, Li K, Xu B, Ye M, Nie Y, Fan D, Zou H: Identification of Chemoresistance-Related Cell-Surface Glycoproteins in Leukemia Cells and Functional Validation of Candidate Glycoproteins. Journal of Proteome Research 2014, 13:1593-1601.
32Zhang Z, Sun Z, Zhu J, Liu J, Huang G, Ye M, Zou H: High-Throughput Determination of the Site-Specific N-Sialoglycan Occupancy Rates by Differential Oxidation of Glycoproteins Followed with Quantitative Glycoproteomics Analysis. Analytical Chemistry 2014, 86:9830-9837.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
34Sun S, Zhang B, Aiyetan P, Zhou J-Y, Shah P, Yang W, Levine DA, Zhang Z, Chan DW, Zhang H: Analysis of N-glycoproteins using Genomic N-glycosite Prediction. Journal of Proteome Research 2013, 12:5609-5615.
37Boersema PJ, Geiger T, Wisniewski JR, Mann M: Quantification of the N-glycosylated Secretome by Super-SILAC During Breast Cancer Progression and in Human Blood Samples. Molecular & Cellular Proteomics 2013, 12:158-171.
38Kaji H, Ocho M, Togayachi A, Kuno A, Sogabe M, Ohkura T, Nozaki H, Angata T, Chiba Y, Ozaki H, et al: Glycoproteomic Discovery of Serological Biomarker Candidates for HCV/HBV Infection-Associated Liver Fibrosis and Hepatocellular Carcinoma. Journal of Proteome Research 2013, 12:2630-2640.
40Li X, Jiang J, Zhao X, Wang J, Han H, Zhao Y, Peng B, Zhong R, Ying W, Qian X: N-glycoproteome Analysis of the Secretome of Human Metastatic Hepatocellular Carcinoma Cell Lines Combining Hydrazide Chemistry, HILIC Enrichment and Mass Spectrometry. Plos One 2013, 8.
42Ma C, Zhao X, Han H, Tong W, Zhang Q, Qin P, Chang C, Peng B, Ying W, Qian X: N-linked glycoproteome profiling of human serum using tandem enrichment and multiple fraction concatenation. Electrophoresis 2013, 34:2440-2450.
45Zhou H, Froehlich JW, Briscoe AC, Lee RS: The GlycoFilter: A Simple and Comprehensive Sample Preparation Platform for Proteomics, N-Glycomics and Glycosylation Site Assignment. Molecular & Cellular Proteomics 2013, 12:2981-2991.
48Danzer C, Eckhardt K, Schmidt A, Fankhauser N, Ribrioux S, Wollscheid B, Mueller L, Schiess R, Zuellig R, Lehmann R, et al: Comprehensive Description of the N-Glycoproteome of Mouse Pancreatic beta-Cells and Human Islets. Journal of Proteome Research 2012, 11:1598-1608.
52Yen T-Y, Macher BA, McDonald CA, Alleyne-Chin C, Timpe LC: Glycoprotein Profiles of Human Breast Cells Demonstrate a Clear Clustering of Normal/Benign versus Malignant Cell Lines and Basal versus Luminal Cell Lines. Journal of Proteome Research 2012, 11:656-667.
54Tian Y, Yao Z, Roden R, Zhang H: Identification of glycoproteins associated with different histological subtypes of ovarian tumors using quantitative glycoproteomics. Proteomics 2011, 11:4677-4687.
58Nagano K, Shinkawa T, Kato K, Inomata N, Yabuki N, Haramura M: Distinct cell surface proteome profiling by biotin labeling and glycoprotein capturing. Journal of Proteomics 2011, 74:1985-1993.
62Arcinas A, Yen T-Y, Kebebew E, Macher BA: Cell Surface and Secreted Protein Profiles of Human Thyroid Cancer Cell Lines Reveal Distinct Glycoprotein Patterns. Journal of Proteome Research 2009, 8:3958-3968.
63Cao J, Shen C, Wang H, Shen H, Chen Y, Nie A, Yan G, Lu H, Liu Y, Yang P: Identification of N-Glycosylation Sites on Secreted Proteins of Human Hepatocellular Carcinoma Cells with a Complementary Proteomics Approach. Journal of Proteome Research 2009, 8:662-672.
64Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res 2009, 8:651-661.
66Jia W, Lu Z, Fu Y, Wang H-P, Wang L-H, Chi H, Yuan Z-F, Zheng Z-B, Song L-N, Han H-H, et al: A Strategy for Precise and Large Scale Identification of Core Fucosylated Glycoproteins. Molecular & Cellular Proteomics 2009, 8:913-923.
67McDonald CA, Yang JY, Marathe V, Yen T-Y, Macher BA: Combining Results from Lectin Affinity Chromatography and Glycocapture Approaches Substantially Improves the Coverage of the Glycoproteome. Molecular & Cellular Proteomics 2009, 8:287-301.
72Hanson SR, Hsu T-L, Weerapana E, Kishikawa K, Simon GM, Cravatt BF, Wong C-H: Tailored glycoproteomics and glycan site mapping using saccharide-selective bioorthogonal probes. Journal of the American Chemical Society 2007, 129:7266-+.
81Liu T, Qian WJ, Gritsenko MA, Camp DG, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. Journal of Proteome Research 2005, 4:2070-2080.