Contains      

UniProtKB-P05976

Protein Myosin light chain 1/3, skeletal muscle isoform
Gene MYL1
Status Reviewed
Source Breast cancer xenografts; Colorectal tumor; Colorectal tumors; Liver; OVCAR-3 cell line (Ovarian cancer); Prostate tumor; Urine
Years 2007-2015

Glycosites

Site Identified Peptides Year(Publication ID)
144 nGTVMGAELR 2015(1);
144 EGnGTVMGAEIR 2014(22); 2015(unpublished);2015(unpublished);
144 EGnGTVMGAELR 2014(22); 2007(unpublished);
144 VFDKEGnGTVMGAEIR 2007(unpublished);2009(68); 2014(33); 2015(unpublished);
144 VFDKEGnGTVMGAELR 2007(unpublished);2014(33); 2015(unpublished);2015(unpublished);

Sequence

1112131415161718191
MAPKKDVKKPVAAAAAAPAPAPAPAPAPAPAKPKEEKIDLSAIKIEFSKEQQDEFKEAFLLFDRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNPSN
101111121131141151161171181191
EELNAKKIEFEQFLPMMQAISNNKDQATYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALMAGQEDSNGCINYEAFVKHIMSI

Reference

ID Publication
1Sun S, Shah P, Eshghi ST, Yang W, Trikannad N, Yang S, Chen L, Aiyetan P, Hoti N, Zhang Z, et al: Comprehensive analysis of protein glycosylation by solid-phase extraction of N-linked glycans and glycosite-containing peptides. Nat Biotech 2015, advance online publication.
22Nicastri A, Gaspari M, Sacco R, Elia L, Gabriele C, Romano R, Rizzuto A, Cuda G: N-Glycoprotein Analysis Discovers New Up-Regulated Glycoproteins in Colorectal Cancer Tissue. Journal of Proteome Research 2014, 13:4932-4941.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
68Zhang L, Xu Y, Yao H, Xie L, Yao J, Lu H, Yang P: Boronic Acid Functionalized Core-Satellite Composite Nanoparticles for Advanced Enrichment of Glycopeptides and Glycoproteins. Chemistry-a European Journal 2009, 15:10158-10166.