Contains      

UniProtKB-P07942

Protein Laminin subunit beta-1
Gene LAMB1
Status Reviewed
Source 22Rv1 cell line (prostate cancer); ARO Cell Line (Thyroid Cance); Bladder stromal cell line; Bladder tumor; Breast Cancer cell lines; Breast cancer cell lines; Breast cancer xenografts; Breast cell lines; Breast tumor; Colorectal tumor; DRO-1 Cell Line (Thyroid Cance); FTC-133 Cell Line (Thyroid Cance); HCC cell lines (Liver); HCCLM3 cell line (Liver); HEK293 cell line (embryonic kidney); HEK293T cell line (embryonic kidney); Hela cell line (cervical cancer); HepG2 cell line (Liver); HuH-7 cell line (Liver); LNCap/PC3 cell lines (Prostate cancer); Liver; Liver tumor (HCC); Non-small Cell Lung Carcinoma; OVCAR-3 cell line (Ovarian cancer); Ovarian cancer cell lines; Ovarian tumor; Pancreatic islets; Plasma; Platelet; Prostate; Prostate cancer metastasis to liver; Prostate stromal cell line; Prostate tumor; SKOV-3 cell line (Ovarian cancer); SW1990 cell line (Pancreatic cancer); Saliva; Serum; TPC-1 Cell Line (Thyroid Cance); Urine; ovarian tumor
Years 2005-20072007

Glycosites

Site Identified Peptides Year(Publication ID)
120 IWWQSENGVEnVTI 2007(unpublished);
356 nVSGGVCDDCQHNTMGR 2015(1);
356 ATGnVSGGVCDDCQHNTMGR 2007(unpublished);2007(unpublished);2007(unpublished);2007 (Unpublished );
356 LATGnVSGGVCDDCQHNTMGR 2007(unpublished);2012(3); 2014(33);
356 LATGnVSGGVCDDCQHNTMGRNCEQCKPF 2014(33);
356 CNCNEHSISCHFDMAVYLATGnVSGGVCDDCQHNTMGR 2012(52);
519 nNSCFAESGQCSCRPHMIGR 2015(1);
519 HWGLSNDLDGCRPCDCDLGGALnNSCFAE 2014(33);
677 GTnYTVR 2012(50); 2013(40); 2014(15); 2014(22); 2014(32); 2014(33); 2015(unpublished);2015(2); 2015(unpublished);2015(unpublished);2015(10); 2015(12);
1041 nGSDCQCDK 2015(1);
1041 TVQEHCnGSDCQC 2013(37);
1041 LGTVQEHCnGSDCQCDK 2012(48);
1041 CVCNYLGTVQEHCnGSDCQCDK 2009(62); 2009(62); 2012(52); 2013(38); 2013(38); 2013(40); 2013(45);
1041 KCVCNYLGTVQEHCnGSDCQCDK 2012(52); 2014(18);
1041 LGTVQEHCnGSDCQCDKATGQCL 2014(33);
1041 CVCNYLGTVQEHCnGSDCQCDKATGQCLCLPNVIGQNCDR 2014(18);
1195 ALWDVIIAELTnR 2007(unpublished);
1279 DTTSQSnSTAKEI 2013(37);
1279 LSDTTSQSnSTAK 2005( 81); 2009(64); 2011(56); 2011(57); 2012(3); 2012(47); 2012(48); 2012(50); 2012(52); 2013(34); 2013(34); 2013(34); 2013(38); 2013(40); 2014(13); 2014(15); 2014(17); 2014(18); 2014(22); 2014(33); 2015(2); 2015(10); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2007(unpublished);2007;2007;2007;2007;
1279 LSDTTSQSnSTAKE 2009(64); 2014(33);
1279 LSDTTSQSnSTAKELDSLQTEAESLDNTVK 2012(52); 2014(15); 2015(2); 2015(12);
1279 LSDTTSQSnSTAKELDSLQTEAESLDNTVKELAEQLEFIK 2015(2);
1336 VnASTTEPNSTVEQSALMR 2009(62); 2009(62); 2009(62); 2009(63); 2009(65); 2009(65); 2011(54); 2011(57); 2012(47); 2012(48); 2012(52); 2013(34); 2013(34); 2013(34); 2013(40); 2014(14); 2014(22); 2015(1); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015;2007;2007;2007;2007;
1343 nSTVEQSALMR 2015(1);
1343 VNASTTEPnSTVEQSALMR 2009(62); 2009(62); 2009(62); 2009(63); 2009(65); 2009(65); 2011(54); 2011(57); 2012(47); 2012(48); 2012(52); 2013(34); 2013(34); 2013(34); 2013(40); 2014(14); 2014(22); 2015(1); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015;2007;2007;2007;2007;
1487 DIIIKTnATKEKM 2013(37);
1487 QSAEDILLKTnATK 2014(18); 2014(33); 2015(unpublished);
1542 nLTEDIR 2015(1);
1542 nLTEDIRER 2015(1);
1542 TPQQIQnITEDIR 2013(37);
1542 MPSTPQQLQnLTEDIRE 2014(33);
1542 MEMPSTPQQIQnITEDIR 2014(32); 2014(32);
1542 MEMPSTPQQLQnLTEDIR 2009(62); 2009(62); 2009(62); 2009(62); 2009(63); 2009(65); 2009(65); 2011(54); 2011(57); 2012(47); 2012(48); 2012(52); 2013(34); 2013(34); 2013(34); 2013(40); 2014(14); 2014(22); 2014(33); 2015(12); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2007(Unpublished ); 2007;2007;2007;2007;2007 ;
1542 MEMPSTPQQLQnLTEDIRER 2013(34); 2015(unpublished);2015(2);
1542 MEMPSTPQQLQnLTEDIRERVESLSQVEVILQHSAADIAR 2015(2);
1643 TLFnASQR 2014(33);
1643 ETLFnASQR 2014(33);
1643 LLTSIESETAASEETLFnASQR 2015(unpublished);
1643 QADEDIQGTQNLLTSIESETAASEETLFnASQR 2011(57); 2012(52); 2014(14); 2014(33); 2015(1); 2015(2); 2015(12); 2015(unpublished);2015(unpublished);2015(unpublished);2015(UnpublishedUnpublished ); 2007;2007;2007;20072007 ;
1643 AIKQADEDIQGTQNLLTSIESETAASEETLFnASQR 2012(52); 2014(18); 2015(2);

Sequence

1112131415161718191
MGLLQLLAFSFLALCRARVRAQEPEFSYGCAEGSCYPATGDLLIGRAQKLSVTSTCGLHKPEPYCIVSHLQEDKKCFICNSQDPYHETLNPDSHLIENVV
101111121131141151161171181191
TTFAPNRLKIWWQSENGVENVTIQLDLEAEFHFTHLIMTFKTFRPAAMLIERSSDFGKTWGVYRYFAYDCEASFPGISTGPMKKVDDIICDSRYSDIEPS
201211221231241251261271281291
TEGEVIFRALDPAFKIEDPYSPRIQNLLKITNLRIKFVKLHTLGDNLLDSRMEIREKYYYAVYDMVVRGNCFCYGHASECAPVDGFNEEVEGMVHGHCMC
301311321331341351361371381391
RHNTKGLNCELCMDFYHDLPWRPAEGRNSNACKKCNCNEHSISCHFDMAVYLATGNVSGGVCDDCQHNTMGRNCEQCKPFYYQHPERDIRDPNFCERCTC
401411421431441451461471481491
DPAGSQNEGICDSYTDFSTGLIAGQCRCKLNVEGEHCDVCKEGFYDLSSEDPFGCKSCACNPLGTIPGGNPCDSETGHCYCKRLVTGQHCDQCLPEHWGL
501511521531541551561571581591
SNDLDGCRPCDCDLGGALNNSCFAESGQCSCRPHMIGRQCNEVEPGYYFATLDHYLYEAEEANLGPGVSIVERQYIQDRIPSWTGAGFVRVPEGAYLEFF
601611621631641651661671681691
IDNIPYSMEYDILIRYEPQLPDHWEKAVITVQRPGRIPTSSRCGNTIPDDDNQVVSLSPGSRYVVLPRPVCFEKGTNYTVRLELPQYTSSDSDVESPYTL
701711721731741751761771781791
IDSLVLMPYCKSLDIFTVGGSGDGVVTNSAWETFQRYRCLENSRSVVKTPMTDVCRNIIFSISALLHQTGLACECDPQGSLSSVCDPNGGQCQCRPNVVG
801811821831841851861871881891
RTCNRCAPGTFGFGPSGCKPCECHLQGSVNAFCNPVTGQCHCFQGVYARQCDRCLPGHWGFPSCQPCQCNGHADDCDPVTGECLNCQDYTMGHNCERCLA
901911921931941951961971981991
GYYGDPIIGSGDHCRPCPCPDGPDSGRQFARSCYQDPVTLQLACVCDPGYIGSRCDDCASGYFGNPSEVGGSCQPCQCHNNIDTTDPEACDKETGRCLKC
1001101110211031104110511061107110811091
LYHTEGEHCQFCRFGYYGDALQQDCRKCVCNYLGTVQEHCNGSDCQCDKATGQCLCLPNVIGQNCDRCAPNTWQLASGTGCDPCNCNAAHSFGPSCNEFT
1101111111211131114111511161117111811191
GQCQCMPGFGGRTCSECQELFWGDPDVECRACDCDPRGIETPQCDQSTGQCVCVEGVEGPRCDKCTRGYSGVFPDCTPCHQCFALWDVIIAELTNRTHRF
1201121112211231124112511261127112811291
LEKAKALKISGVIGPYRETVDSVERKVSEIKDILAQSPAAEPLKNIGNLFEEAEKLIKDVTEMMAQVEVKLSDTTSQSNSTAKELDSLQTEAESLDNTVK
1301131113211331134113511361137113811391
ELAEQLEFIKNSDIRGALDSITKYFQMSLEAEERVNASTTEPNSTVEQSALMRDRVEDVMMERESQFKEKQEEQARLLDELAGKLQSLDLSAAAEMTCGT
1401141114211431144114511461147114811491
PPGASCSETECGGPNCRTDEGERKCGGPGCGGLVTVAHNAWQKAMDLDQDVLSALAEVEQLSKMVSEAKLRADEAKQSAEDILLKTNATKEKMDKSNEEL
1501151115211531154115511561157115811591
RNLIKQIRNFLTQDSADLDSIEAVANEVLKMEMPSTPQQLQNLTEDIRERVESLSQVEVILQHSAADIARAEMLLEEAKRASKSATDVKVTADMVKEALE
1601161116211631164116511661167116811691
EAEKAQVAAEKAIKQADEDIQGTQNLLTSIESETAASEETLFNASQRISELERNVEELKRKAAQNSGEAEYIEKVVYTVKQSAEDVKKTLDGELDEKYKK
170117111721173117411751176117711781
VENLIAKKTEESADARRKAEMLQNEAKTLLAQANSKLQLLKDLERKYEDNQRYLEDKAQELARLEGEVRSLLKDISQKVAVYSTCL

Reference

ID Publication
1Sun S, Shah P, Eshghi ST, Yang W, Trikannad N, Yang S, Chen L, Aiyetan P, Hoti N, Zhang Z, et al: Comprehensive analysis of protein glycosylation by solid-phase extraction of N-linked glycans and glycosite-containing peptides. Nat Biotech 2015, advance online publication.
2Shah P, Wang X, Yang W, Eshghi ST, Sun S, Hoti N, Chen L, Yang S, Pasay J, Rubin A: Integrated Proteomic and Glycoproteomic Analyses of Prostate Cancer Cells Reveal Glycoprotein Alteration in Protein Abundance and Glycosylation. Molecular & Cellular Proteomics 2015, 14:2753-2763.
3Tian Y, Almaraz RT, Choi CH, Li QK, Saeui C, Li D, Shah P, Bhattacharya R, Yarema KJ, Zhang H: Identification of sialylated glycoproteins from metabolically oligosaccharide engineered pancreatic cells. Clinical proteomics 2015, 12:11.
10Tan ZJ, Yin HD, Nie S, Lin ZX, Zhu JH, Ruffin MT, Anderson MA, Simone DM, Lubman DM: Large-Scale Identification of Core-Fucosylated Glycopeptide Sites in Pancreatic Cancer Serum Using Mass Spectrometry. Journal of Proteome Research 2015, 14:1968-1978.
12Weng Y, Sui Z, Jiang H, Shan Y, Chen L, Zhang S, Zhang L, Zhang Y: Releasing N-glycan from Peptide N-terminus by N-terminal Succinylation Assisted Enzymatic Deglycosylation. Scientific Reports 2015, 5.
13Yang W, Laeyendecker O, Wendel SK, Zhang B, Sun S, Zhou J-Y, Ao M, Moore RD, Jackson JB, Zhang H: Glycoproteomic Study Reveals Altered Plasma Proteins Associated with HIV Elite Suppressors. Theranostics 2014, 4:1153.
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
15Chen R, Seebun D, Ye M, Zou H, Figeys D: Site-specific characterization of cell membrane N-glycosylation with integrated hydrophilic interaction chromatography solid phase extraction and LC-MS/MS. Journal of Proteomics 2014, 103:194-203.
17Fang C, Xiong Z, Qin H, Huang G, Liu J, Ye M, Feng S, Zou H: One-pot synthesis of magnetic colloidal nanocrystal clusters coated with chitosan for selective enrichment of glycopeptides. Analytica Chimica Acta 2014, 841:99-105.
18Hirao Y, Matsuzaki H, Iwaki J, Kuno A, Kaji H, Ohkura T, Togayachi A, Abe M, Nomura M, Noguchi M, et al: Glycoproteomics Approach for Identifying Glycobiomarker Candidate Molecules for Tissue Type Classification of Non-small Cell Lung Carcinoma. Journal of Proteome Research 2014, 13:4705-4716.
22Nicastri A, Gaspari M, Sacco R, Elia L, Gabriele C, Romano R, Rizzuto A, Cuda G: N-Glycoprotein Analysis Discovers New Up-Regulated Glycoproteins in Colorectal Cancer Tissue. Journal of Proteome Research 2014, 13:4932-4941.
32Zhang Z, Sun Z, Zhu J, Liu J, Huang G, Ye M, Zou H: High-Throughput Determination of the Site-Specific N-Sialoglycan Occupancy Rates by Differential Oxidation of Glycoproteins Followed with Quantitative Glycoproteomics Analysis. Analytical Chemistry 2014, 86:9830-9837.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
34Sun S, Zhang B, Aiyetan P, Zhou J-Y, Shah P, Yang W, Levine DA, Zhang Z, Chan DW, Zhang H: Analysis of N-glycoproteins using Genomic N-glycosite Prediction. Journal of Proteome Research 2013, 12:5609-5615.
37Boersema PJ, Geiger T, Wisniewski JR, Mann M: Quantification of the N-glycosylated Secretome by Super-SILAC During Breast Cancer Progression and in Human Blood Samples. Molecular & Cellular Proteomics 2013, 12:158-171.
38Kaji H, Ocho M, Togayachi A, Kuno A, Sogabe M, Ohkura T, Nozaki H, Angata T, Chiba Y, Ozaki H, et al: Glycoproteomic Discovery of Serological Biomarker Candidates for HCV/HBV Infection-Associated Liver Fibrosis and Hepatocellular Carcinoma. Journal of Proteome Research 2013, 12:2630-2640.
40Li X, Jiang J, Zhao X, Wang J, Han H, Zhao Y, Peng B, Zhong R, Ying W, Qian X: N-glycoproteome Analysis of the Secretome of Human Metastatic Hepatocellular Carcinoma Cell Lines Combining Hydrazide Chemistry, HILIC Enrichment and Mass Spectrometry. Plos One 2013, 8.
45Zhou H, Froehlich JW, Briscoe AC, Lee RS: The GlycoFilter: A Simple and Comprehensive Sample Preparation Platform for Proteomics, N-Glycomics and Glycosylation Site Assignment. Molecular & Cellular Proteomics 2013, 12:2981-2991.
47Almaraz RT, Tian Y, Bhattarcharya R, Tan E, Chen S-H, Dallas MR, Chen L, Zhang Z, Zhang H, Konstantopoulos K: Metabolic flux increases glycoprotein sialylation: implications for cell adhesion and cancer metastasis. Molecular & Cellular Proteomics 2012, 11:M112. 017558.
48Danzer C, Eckhardt K, Schmidt A, Fankhauser N, Ribrioux S, Wollscheid B, Mueller L, Schiess R, Zuellig R, Lehmann R, et al: Comprehensive Description of the N-Glycoproteome of Mouse Pancreatic beta-Cells and Human Islets. Journal of Proteome Research 2012, 11:1598-1608.
50Whitmore TE, Peterson A, Holzman T, Eastham A, Amon L, McIntosh M, Ozinsky A, Nelson PS, Martin DB: Integrative Analysis of N-Linked Human Glycoproteomic Data Sets Reveals PTPRF Ectodomain as a Novel Plasma Biomarker Candidate for Prostate Cancer. Journal of Proteome Research 2012, 11:2653-2665.
52Yen T-Y, Macher BA, McDonald CA, Alleyne-Chin C, Timpe LC: Glycoprotein Profiles of Human Breast Cells Demonstrate a Clear Clustering of Normal/Benign versus Malignant Cell Lines and Basal versus Luminal Cell Lines. Journal of Proteome Research 2012, 11:656-667.
54Tian Y, Yao Z, Roden R, Zhang H: Identification of glycoproteins associated with different histological subtypes of ovarian tumors using quantitative glycoproteomics. Proteomics 2011, 11:4677-4687.
56Bandhakavi S, Van Riper SK, Tawfik PN, Stone MD, Haddad T, Rhodus NL, Carlis JV, Griffin TJ: Hexapeptide Libraries for Enhanced Protein PTM Identification and Relative Abundance Profiling in Whole Human Saliva. Journal of Proteome Research 2011, 10:1052-1061.
57Chen Y, Cao J, Yan G, Lu H, Yang P: Two-step protease digestion and glycopeptide capture approach for accurate glycosite identification and glycoprotein sequence coverage improvement. Talanta 2011, 85:70-75.
62Arcinas A, Yen T-Y, Kebebew E, Macher BA: Cell Surface and Secreted Protein Profiles of Human Thyroid Cancer Cell Lines Reveal Distinct Glycoprotein Patterns. Journal of Proteome Research 2009, 8:3958-3968.
63Cao J, Shen C, Wang H, Shen H, Chen Y, Nie A, Yan G, Lu H, Liu Y, Yang P: Identification of N-Glycosylation Sites on Secreted Proteins of Human Hepatocellular Carcinoma Cells with a Complementary Proteomics Approach. Journal of Proteome Research 2009, 8:662-672.
64Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res 2009, 8:651-661.
65Goo YA, Lilu AY, Ryu S, Shaffer SA, Malmstrom L, Page L, Nguyen LT, Doneanu CE, Goodlett DR: Identification of Secreted Glycoproteins of Human Prostate and Bladder Stromal Cells by Comparative Quantitative Proteomics. Prostate 2009, 69:49-61.