Contains      

UniProtKB-P08246

Protein Neutrophil elastase
Gene ELANE
Status Reviewed
Source Bladder tumor; Breast cancer xenografts; Colorectal tumor; Liver; Liver tumor (HCC); Ovarian tumor; Ovarian tumorPBMC Macrophage cells; Prostate; Prostate cancer metastasis to liver; Prostate tumor; Saliva; Serum; Urine; lung
Years 2007-20072007

Glycosites

Site Identified Peptides Year(Publication ID)
88 LGAHnLSR 2014(14); 2014(33); 2015(unpublished);
88 VVLGAHnL 2014(33);
88 VLGAHnLSR 2014(14); 2014(33); 2015(unpublished);
88 VVIGAHnISR 2014(32); 2014(32);
88 VVLGAHnLSR 2007(64); 2009(56); 2011(39); 2013(14); 2014(22); 2014(33); 2014(unpublished);2015(unpublished);2015(unpublished);2015;2015;2015;2015;2007;2007;2007;
88 AVRVVLGAHnLSR 2014(33);
124 IFENGYDPVNLLNDIVILQLnGSATINANVQVAQLPAQGR 2015(unpublished);
173 GIASVLQELnV 2014(14);
173 LnVTVVTSLCR 2014(33);
173 GIASVLQELnVT 2014(14); 2015(unpublished);
173 NRGIASVLQELnV 2014(14);
173 GIASVLQELnVTVV 2014(14); 2015(unpublished);2007(UnpublishedUnpublished ); 20072007 ;
173 GIASVLQELnVTVVT 2014(14); 2015(unpublished);
173 NRGIASVLQELnVTVV 2014(14); 2015(unpublished);
173 GIASVLQELnVTVVTSLCR 2009(64); 2014(14); 2014(33); 2015(unpublished);2015(unpublished);2015(unpublished);
173 GIASVLQELnVTVVTSLCRR 2014(33);

Sequence

1112131415161718191
MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLIAPNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFA
101111121131141151161171181191
VQRIFENGYDPVNLLNDIVILQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFG
201211221231241251261
DSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQRSEDNPCPHPRDPDPASRTH

Reference

ID Publication
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
22Nicastri A, Gaspari M, Sacco R, Elia L, Gabriele C, Romano R, Rizzuto A, Cuda G: N-Glycoprotein Analysis Discovers New Up-Regulated Glycoproteins in Colorectal Cancer Tissue. Journal of Proteome Research 2014, 13:4932-4941.
32Zhang Z, Sun Z, Zhu J, Liu J, Huang G, Ye M, Zou H: High-Throughput Determination of the Site-Specific N-Sialoglycan Occupancy Rates by Differential Oxidation of Glycoproteins Followed with Quantitative Glycoproteomics Analysis. Analytical Chemistry 2014, 86:9830-9837.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
39Li QK, Shah P, Li Y, Aiyetan PO, Chen J, Yung R, Molena D, Gabrielson E, Askin F, Chan DW, Zhang H: Glycoproteomic Analysis of Bronchoalveolar Lavage (BAL) Fluid Identifies Tumor-Associated Glycoproteins from Lung Adenocarcinonna. Journal of Proteome Research 2013, 12:3689-3696.
56Bandhakavi S, Van Riper SK, Tawfik PN, Stone MD, Haddad T, Rhodus NL, Carlis JV, Griffin TJ: Hexapeptide Libraries for Enhanced Protein PTM Identification and Relative Abundance Profiling in Whole Human Saliva. Journal of Proteome Research 2011, 10:1052-1061.
64Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res 2009, 8:651-661.