Contains      

UniProtKB-P09326

Protein CD48 antigen
Gene CD48
Status Reviewed
Source Colorectal tumor; DLBCL cell lines (Diffuse large B-cell lymphoma); Human; Jurkat T cell line; Liver; Liver tumor (HCC); Lymphocytes; Ovarian tumor; Platelet; Prostate; Prostate tumor; Urine; UrineJurkat T cell line
Years 2007-2015

Glycosites

Site Identified Peptides Year(Publication ID)
104 DnSTYIMR 2014(33);
104 EDnSTYIMR 2014(13); 2014(14); 2014(22); 2014(33); 2015(unpublished);2015(unpublished);2007;2007;
104 ISKVQKEDnSTY 2014(33);
104 VQKEDnSTYIMR 2013(34); 2014(13); 2014(14); 2014(16); 2014(33); 2015(unpublished);2015(unpublished);
104 LYISKVQKEDnSTYIMRVLK 2015(6);
162 LSCVIPGESVnYTWYGDK 2014(22); 2014(33); 2015(unpublished);
162 ISCVIPGESVnYTWYGDKRPFPK 2014(16);
189 TTLMPHnYSR 2014(33);
189 EIQNSVIETTIMPHnYSR 2014(16); 2014(32); 2014(32);
189 ELQNSVLETTLMPHnYSR 2007(13); 2014(14); 2014(22); 2014(33); 2014(unpublished);2015(unpublished);2015(unpublished);2015;2015;2007;2007;2007;
206 nGTVCISPPCTIAR 2014(16);
206 nGTVCLSPPCTLAR 2014(13); 2014(33);

Sequence

1112131415161718191
MCSRGWDSCLALELLLLPLSLLVTSIQGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQ
101111121131141151161171181191
KEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSN
201211221231241
SVSSKNGTVCLSPPCTLARSFGVEWIASWLVVTVPTILGLLLT

Reference

ID Publication
6Kim DS, Hahn Y: The acquisition of novel N-glycosylation sites in conserved proteins during human evolution. Bmc Bioinformatics 2015, 16.
13Yang W, Laeyendecker O, Wendel SK, Zhang B, Sun S, Zhou J-Y, Ao M, Moore RD, Jackson JB, Zhang H: Glycoproteomic Study Reveals Altered Plasma Proteins Associated with HIV Elite Suppressors. Theranostics 2014, 4:1153.
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
16Deeb SJ, Cox J, Schmidt-Supprian M, Mann M: N-linked Glycosylation Enrichment for In-depth Cell Surface Proteomics of Diffuse Large B-cell Lymphoma Subtypes. Molecular & Cellular Proteomics 2014, 13:240-251.
22Nicastri A, Gaspari M, Sacco R, Elia L, Gabriele C, Romano R, Rizzuto A, Cuda G: N-Glycoprotein Analysis Discovers New Up-Regulated Glycoproteins in Colorectal Cancer Tissue. Journal of Proteome Research 2014, 13:4932-4941.
32Zhang Z, Sun Z, Zhu J, Liu J, Huang G, Ye M, Zou H: High-Throughput Determination of the Site-Specific N-Sialoglycan Occupancy Rates by Differential Oxidation of Glycoproteins Followed with Quantitative Glycoproteomics Analysis. Analytical Chemistry 2014, 86:9830-9837.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
34Sun S, Zhang B, Aiyetan P, Zhou J-Y, Shah P, Yang W, Levine DA, Zhang Z, Chan DW, Zhang H: Analysis of N-glycoproteins using Genomic N-glycosite Prediction. Journal of Proteome Research 2013, 12:5609-5615.