Contains      

UniProtKB-P10253

Protein Lysosomal alpha-glucosidase
Gene GAA
Status Reviewed
Source 22Rv1 cell line (prostate cancer); 22Rv1 cell xenograft (prostate cancer); ARO Cell Line (Thyroid Cance); Breast Cancer cell lines; Breast cancer cell lines; Breast cancer xenografts; Breast cancer xenograftsPBMC Macrophage cells; Breast cell lines; Breast tumor; Cerebrospinal fluid; Colorectal cancer cell line, HCT-116 (colorectal cancer); Colorectal tumor; DLBCL cell lines (Diffuse large B-cell lymphoma); DRO-1 Cell Line (Thyroid Cance); HCC cell lines (Liver); HCCLM3 cell line (Liver); HEK293 cell line (embryonic kidney); HEK293T cell line (embryonic kidney); HeLa cell line (Cervical cancer); Hela cell line (cervical cancer); HepG2 cell line (Liver); HuH-7 cell line (Liver); IGROV-1/CP cell line (Ovarian cancer)IGROV-1/CP; LNCap/PC3 cell lines (Prostate cancer); Liver; Liver tumor (HCC); LnCap cell line (Prostate cancer); Lung Adenocarcinoma; Non-small Cell Lung Carcinoma; OVCAR-3 cell line (Ovarian cancer); Ovarian cancer cell lines; Ovarian tumor; Pancreatic islets; Plasma; Platelet; Prostate; Prostate cancer cell lines; Prostate tumor; SKOV-3 cell line (Ovarian cancer); Saliva; Spermatozoa; TPC-1 Cell Line (Thyroid Cance); Urine; UrineJurkat T cell line; XTC-1 Cell Line (Thyroid Cance); lung; ovarian tumor; prostate cancer cell lines; umbilical vein Endothelial Cells
Years 2003-2015

Glycosites

Site Identified Peptides Year(Publication ID)
140 LEnLSSSE 2014(33);
140 KLEnLSSSE 2014(33);
140 KLEnLSSSEM 2014(33);
140 LEnLSSSEMGY 2014(33);
140 KLEnLSSSEMGY 2014(33);
140 PSYKIEnISSSEM 2013(37);
140 KLEnLSSSEMGYTAT 2014(33);
140 LEnLSSSEMGYTATL 2014(33);
140 nLSSSEMGYTATLTR 2015(1);
140 KLEnLSSSEMGYTATL 2014(33);
140 IEnISSSEMGYTATITR 2013(43); 2014(16); 2014(32); 2014(32);
140 LEnLSSSEMGYTATLTR 2007(75); 2007(62); 2009(62); 2009(62); 2009(62); 2009(64); 2009(67); 2009(54); 2011(55); 2011(56); 2011(57); 2011(58); 2011(48); 2012(51); 2012(52); 2012(34); 2013(34); 2013(34); 2013(38); 2013(39); 2013(40); 2013(45); 2013(13); 2014(14); 2014(36); 2014(19); 2014(22); 2014(33); 2014(1); 2015(2); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015;2007;2007;2007;2007;2007;2007;
140 KLEnLSSSEMGYTATLTR 2011(57); 2014(33);
140 GQPWCFFPPSYPSYKLEnLSSSEMGYTATLTR 2014(33);
233 nTTVAPL 2014(33);
233 LnTTVAPL 2014(33);
233 VLLnTTVAPL 2012(48); 2014(33); 2007(unpublished);2007(unpublished);2007(unpublished);2007(unpublished);
233 VLLnTTVAPLF 2007(unpublished);2014(14); 2015(unpublished);
233 GRVLLnTTVAPL 2014(33);
233 VLLnTTVAPLFF 2014(33);
233 DGRVLLnTTVAPL 2014(33);
233 DGRVLLnTTVAPLF 2014(33);
233 QLDGRVLLnTTVAPL 2014(33);
233 VLLnTTVAPLFFADQF 2014(14); 2015(unpublished);
390 VVEnMTR 2014(14); 2015(unpublished);
390 QVVEnMTR 2007(62); 2009(62); 2009(56); 2011(48); 2012(52); 2012(38); 2013(38); 2013(40); 2013(45); 2013(16); 2014(18); 2014(19); 2014(32); 2014(32); 2014(33); 2014(2); 2015(12); 2015(unpublished);2015(unpublished);2015;2015;2015;2015;2007;2007;
390 TRQVVEnMTR 2014(33);
390 TRQVVEnMTRA 2014(33);
390 TRQVVEnMTRAHF 2013(37);
390 SSTAITRQVVEnMTR 2014(33);
390 GYSSTAITRQVVEnMTR 2014(33);
390 QVVEnMTRAHFPLDVQW 2014(33);
390 QVVEnMTRAHFPLDVQWNDLDYMDSR 2005(81);
390 QVVEnMTRAHFPLDVQWNDLDYMDSRRDF 2014(33);
470 GVFITnE 2014(33);
470 RGVFITnE 2014(33);
470 ITnETGQPL 2014(33);
470 nETGQPLIGK 2015(unpublished);2015(1);
470 GVFITnETGQPL 2014(14); 2014(33); 2015(unpublished);
470 ITnETGQPLIGK 2009(64); 2012(48); 2014(14); 2014(33);
470 FITnETGQPLIGK 2012(48);
470 RGVFITnETGQPI 2013(37);
470 RGVFITnETGQPL 2014(33);
470 VFITnETGQPLIGK 2012(48); 2014(33);
470 GVFITnETGQPIIGK 2014(32); 2014(32);
470 GVFITnETGQPLIGK 2003( 83); 2007(72); 2007(75); 2007(62); 2009(62); 2009(62); 2009(62); 2009(63); 2009(64); 2009(54); 2011(55); 2011(56); 2011(57); 2011(3); 2012(48); 2012(50); 2012(50); 2012(51); 2012(52); 2012(34); 2013(34); 2013(34); 2013(39); 2013(40); 2013(45); 2013(13); 2014(14); 2014(36); 2014(15); 2014(18); 2014(19); 2014(22); 2014(33); 2014(1); 2015(2); 2015(12); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015;2015;2007;2007;2007;2007;2007;2007;
470 RGVFITnETGQPIIGK 2013(43); 2014(16);
470 RGVFITnETGQPLIGK 2009(62); 2009(62); 2009(64); 2011(57); 2012(48); 2012(52); 2013(34); 2013(34); 2013(34); 2013(45); 2014(14); 2014(15); 2014(33); 2015(1); 2015(2); 2015(unpublished);2015(unpublished);2015(unpublished);2015(12);
652 LGnTSEEL 2014(33);
652 nTSEELCVR 2014(33); 2015(1);
652 GFLGnTSEEL 2014(33);
652 GnTSEELCVR 2014(33);
652 LGnTSEELCVR 2012(48); 2014(33);
652 LGnTSEELCVRW 2014(33);
652 GFLGnTSEELCVR 2014(33);
652 VGADVCGFLGnTSEEL 2014(33);
652 VGADVCGFLGnTSEELCVR 2014(33);
652 GVPLVGADVCGFLGnTSEELCVR 2014(33);
652 ILQFNLLGVPLVGADVCGFLGnTSEE 2014(33);
882 LARnNTIVN 2014(33);
882 ARnNTIVNEL 2014(33);
882 nNTIVNEIVR 2013(43); 2014(16);
882 nNTIVNELVR 2007(75); 2007(62); 2009(62); 2009(62); 2009(62); 2009(63); 2009(64); 2009(55); 2011(57); 2011(58); 2011(50); 2012(50); 2012(51); 2012(52); 2012(34); 2013(34); 2013(34); 2013(39); 2013(40); 2013(44); 2013(45); 2013(13); 2014(14); 2014(36); 2014(15); 2014(22); 2014(33); 2014(1); 2015(2); 2015(12); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2007(unpublished);2007;2007;2007;2007;
882 LARnNTIVNEL 2014(33);
882 ARnNTIVNELVR 2014(33);
882 LARnNTIVNELV 2014(33);
882 LARnNTIVNELVR 2014(33);
882 VIFIARnNTIVNE 2013(37);
882 ARnNTIVNELVRVTSEGAGL 2014(33);
882 GAYTQVIFLARnNTIVNELVR 2012(52);
882 LARnNTIVNELVRVTSEGAGL 2014(33);
882 nNTIVNELVRVTSEGAGLQLQK 2012(52);
925 nFTYSPDTK 2015(1);
925 SNGVPVSnF 2014(33);
925 SnFTYSPDTK 2014(14); 2015(unpublished);
925 VSnFTYSPDTK 2014(33);
925 GVPVSnFTYSPDTK 2014(14); 2014(33);
925 NGVPVSnFTYSPDTK 2014(33);
925 SNGVPVSnFTYSPDTK 2014(33);
925 SNGVPVSnFTYSPDTKVL 2014(33);
925 GVATAPQQVLSNGVPVSnF 2014(33);
925 VTVLGVATAPQQVLSNGVPVSnF 2014(33);
925 GVATAPQQVLSNGVPVSnFTYSPDTK 2014(33);
925 VTVIGVATAPQQVISNGVPVSnFTYSPDTK 2014(32); 2014(32);
925 VTVLGVATAPQQVLSNGVPVSnFTYSPDTK 2009(62); 2009(62); 2009(62); 2009(62); 2009(64); 2011(57); 2012(50); 2012(52); 2013(34); 2013(34); 2013(40); 2013(45); 2014(14); 2014(15); 2014(33); 2015(1); 2015(2); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2007(unpublished);2007;2007;2007;2007;2007;

Sequence

1112131415161718191
MGVRHPPCSHRLLAVCALVSLATAALLGHILLHDFLLVPRELSGSSPVLEETHPAHQQGASRPGPRDAQAHPGRPRAVPTQCDVPPNSRFDCAPDKAITQ
101111121131141151161171181191
EQCEARGCCYIPAKQGLQGAQMGQPWCFFPPSYPSYKLENLSSSEMGYTATLTRTTPTFFPKDILTLRLDVMMETENRLHFTIKDPANRRYEVPLETPHV
201211221231241251261271281291
HSRAPSPLYSVEFSEEPFGVIVRRQLDGRVLLNTTVAPLFFADQFLQLSTSLPSQYITGLAEHLSPLMLSTSWTRITLWNRDLAPTPGANLYGSHPFYLA
301311321331341351361371381391
LEDGGSAHGVFLLNSNAMDVVLQPSPALSWRSTGGILDVYIFLGPEPKSVVQQYLDVVGYPFMPPYWGLGFHLCRWGYSSTAITRQVVENMTRAHFPLDV
401411421431441451461471481491
QWNDLDYMDSRRDFTFNKDGFRDFPAMVQELHQGGRRYMMIVDPAISSSGPAGSYRPYDEGLRRGVFITNETGQPLIGKVWPGSTAFPDFTNPTALAWWE
501511521531541551561571581591
DMVAEFHDQVPFDGMWIDMNEPSNFIRGSEDGCPNNELENPPYVPGVVGGTLQAATICASSHQFLSTHYNLHNLYGLTEAIASHRALVKARGTRPFVISR
601611621631641651661671681691
STFAGHGRYAGHWTGDVWSSWEQLASSVPEILQFNLLGVPLVGADVCGFLGNTSEELCVRWTQLGAFYPFMRNHNSLLSLPQEPYSFSEPAQQAMRKALT
701711721731741751761771781791
LRYALLPHLYTLFHQAHVAGETVARPLFLEFPKDSSTWTVDHQLLWGEALLITPVLQAGKAEVTGYFPLGTWYDLQTVPVEALGSLPPPPAAPREPAIHS
801811821831841851861871881891
EGQWVTLPAPLDTINVHLRAGYIIPLQGPGLTTTESRQQPMALAVALTKGGEARGELFWDDGESLEVLERGAYTQVIFLARNNTIVNELVRVTSEGAGLQ
901911921931941951
LQKVTVLGVATAPQQVLSNGVPVSNFTYSPDTKVLDICVSLLMGEQFLVSWC

Reference

ID Publication
1Sun S, Shah P, Eshghi ST, Yang W, Trikannad N, Yang S, Chen L, Aiyetan P, Hoti N, Zhang Z, et al: Comprehensive analysis of protein glycosylation by solid-phase extraction of N-linked glycans and glycosite-containing peptides. Nat Biotech 2015, advance online publication.
2Shah P, Wang X, Yang W, Eshghi ST, Sun S, Hoti N, Chen L, Yang S, Pasay J, Rubin A: Integrated Proteomic and Glycoproteomic Analyses of Prostate Cancer Cells Reveal Glycoprotein Alteration in Protein Abundance and Glycosylation. Molecular & Cellular Proteomics 2015, 14:2753-2763.
3Tian Y, Almaraz RT, Choi CH, Li QK, Saeui C, Li D, Shah P, Bhattacharya R, Yarema KJ, Zhang H: Identification of sialylated glycoproteins from metabolically oligosaccharide engineered pancreatic cells. Clinical proteomics 2015, 12:11.
12Weng Y, Sui Z, Jiang H, Shan Y, Chen L, Zhang S, Zhang L, Zhang Y: Releasing N-glycan from Peptide N-terminus by N-terminal Succinylation Assisted Enzymatic Deglycosylation. Scientific Reports 2015, 5.
13Yang W, Laeyendecker O, Wendel SK, Zhang B, Sun S, Zhou J-Y, Ao M, Moore RD, Jackson JB, Zhang H: Glycoproteomic Study Reveals Altered Plasma Proteins Associated with HIV Elite Suppressors. Theranostics 2014, 4:1153.
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
15Chen R, Seebun D, Ye M, Zou H, Figeys D: Site-specific characterization of cell membrane N-glycosylation with integrated hydrophilic interaction chromatography solid phase extraction and LC-MS/MS. Journal of Proteomics 2014, 103:194-203.
16Deeb SJ, Cox J, Schmidt-Supprian M, Mann M: N-linked Glycosylation Enrichment for In-depth Cell Surface Proteomics of Diffuse Large B-cell Lymphoma Subtypes. Molecular & Cellular Proteomics 2014, 13:240-251.
18Hirao Y, Matsuzaki H, Iwaki J, Kuno A, Kaji H, Ohkura T, Togayachi A, Abe M, Nomura M, Noguchi M, et al: Glycoproteomics Approach for Identifying Glycobiomarker Candidate Molecules for Tissue Type Classification of Non-small Cell Lung Carcinoma. Journal of Proteome Research 2014, 13:4705-4716.
19Huang G, Sun Z, Qin H, Zhao L, Xiong Z, Peng X, Ou J, Zou H: Preparation of hydrazine functionalized polymer brushes hybrid magnetic nanoparticles for highly specific enrichment of glycopeptides. Analyst 2014, 139:2199-2206.
22Nicastri A, Gaspari M, Sacco R, Elia L, Gabriele C, Romano R, Rizzuto A, Cuda G: N-Glycoprotein Analysis Discovers New Up-Regulated Glycoproteins in Colorectal Cancer Tissue. Journal of Proteome Research 2014, 13:4932-4941.
32Zhang Z, Sun Z, Zhu J, Liu J, Huang G, Ye M, Zou H: High-Throughput Determination of the Site-Specific N-Sialoglycan Occupancy Rates by Differential Oxidation of Glycoproteins Followed with Quantitative Glycoproteomics Analysis. Analytical Chemistry 2014, 86:9830-9837.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
34Sun S, Zhang B, Aiyetan P, Zhou J-Y, Shah P, Yang W, Levine DA, Zhang Z, Chan DW, Zhang H: Analysis of N-glycoproteins using Genomic N-glycosite Prediction. Journal of Proteome Research 2013, 12:5609-5615.
36Li QK, Shah P, Li Y, Aiyetan PO, Chen J, Yung R, Molena D, Gabrielson E, Askin F, Chan DW: Glycoproteomic analysis of bronchoalveolar lavage (BAL) fluid identifies tumor-associated glycoproteins from lung adenocarcinoma. Journal of proteome research 2013, 12:3689-3696.
37Boersema PJ, Geiger T, Wisniewski JR, Mann M: Quantification of the N-glycosylated Secretome by Super-SILAC During Breast Cancer Progression and in Human Blood Samples. Molecular & Cellular Proteomics 2013, 12:158-171.
38Kaji H, Ocho M, Togayachi A, Kuno A, Sogabe M, Ohkura T, Nozaki H, Angata T, Chiba Y, Ozaki H, et al: Glycoproteomic Discovery of Serological Biomarker Candidates for HCV/HBV Infection-Associated Liver Fibrosis and Hepatocellular Carcinoma. Journal of Proteome Research 2013, 12:2630-2640.
39Li QK, Shah P, Li Y, Aiyetan PO, Chen J, Yung R, Molena D, Gabrielson E, Askin F, Chan DW, Zhang H: Glycoproteomic Analysis of Bronchoalveolar Lavage (BAL) Fluid Identifies Tumor-Associated Glycoproteins from Lung Adenocarcinonna. Journal of Proteome Research 2013, 12:3689-3696.
40Li X, Jiang J, Zhao X, Wang J, Han H, Zhao Y, Peng B, Zhong R, Ying W, Qian X: N-glycoproteome Analysis of the Secretome of Human Metastatic Hepatocellular Carcinoma Cell Lines Combining Hydrazide Chemistry, HILIC Enrichment and Mass Spectrometry. Plos One 2013, 8.
43Wang GG, Wu YB, Zhou T, Guo YS, Zheng B, Wang J, Bi Y, Liu FJ, Zhou ZM, Guo XJ, Sha JH: Mapping of the N-Linked Glycoproteome of Human Spermatozoa. Journal of Proteome Research 2013, 12:5750-5759.
44Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M: Glycoproteomic Analysis of the Secretome of Human Endothelial Cells. Molecular & Cellular Proteomics 2013, 12:956-978.
45Zhou H, Froehlich JW, Briscoe AC, Lee RS: The GlycoFilter: A Simple and Comprehensive Sample Preparation Platform for Proteomics, N-Glycomics and Glycosylation Site Assignment. Molecular & Cellular Proteomics 2013, 12:2981-2991.
48Danzer C, Eckhardt K, Schmidt A, Fankhauser N, Ribrioux S, Wollscheid B, Mueller L, Schiess R, Zuellig R, Lehmann R, et al: Comprehensive Description of the N-Glycoproteome of Mouse Pancreatic beta-Cells and Human Islets. Journal of Proteome Research 2012, 11:1598-1608.
50Whitmore TE, Peterson A, Holzman T, Eastham A, Amon L, McIntosh M, Ozinsky A, Nelson PS, Martin DB: Integrative Analysis of N-Linked Human Glycoproteomic Data Sets Reveals PTPRF Ectodomain as a Novel Plasma Biomarker Candidate for Prostate Cancer. Journal of Proteome Research 2012, 11:2653-2665.
51Yeh C-H, Chen S-H, Li D-T, Lin H-P, Huang H-J, Chang C-I, Shih W-L, Chern C-L, Shi F-K, Hsu J-L: Magnetic bead-based hydrophilic interaction liquid chromatography for glycopeptide enrichments. Journal of Chromatography A 2012, 1224:70-78.
52Yen T-Y, Macher BA, McDonald CA, Alleyne-Chin C, Timpe LC: Glycoprotein Profiles of Human Breast Cells Demonstrate a Clear Clustering of Normal/Benign versus Malignant Cell Lines and Basal versus Luminal Cell Lines. Journal of Proteome Research 2012, 11:656-667.
54Tian Y, Yao Z, Roden R, Zhang H: Identification of glycoproteins associated with different histological subtypes of ovarian tumors using quantitative glycoproteomics. Proteomics 2011, 11:4677-4687.
55Tian Y, Bova GS, Zhang H: Quantitative glycoproteomic analysis of optimal cutting temperature-embedded frozen tissues identifying glycoproteins associated with aggressive prostate cancer. Analytical chemistry 2011, 83:7013-7019.
56Bandhakavi S, Van Riper SK, Tawfik PN, Stone MD, Haddad T, Rhodus NL, Carlis JV, Griffin TJ: Hexapeptide Libraries for Enhanced Protein PTM Identification and Relative Abundance Profiling in Whole Human Saliva. Journal of Proteome Research 2011, 10:1052-1061.
57Chen Y, Cao J, Yan G, Lu H, Yang P: Two-step protease digestion and glycopeptide capture approach for accurate glycosite identification and glycoprotein sequence coverage improvement. Talanta 2011, 85:70-75.
58Nagano K, Shinkawa T, Kato K, Inomata N, Yabuki N, Haramura M: Distinct cell surface proteome profiling by biotin labeling and glycoprotein capturing. Journal of Proteomics 2011, 74:1985-1993.
62Arcinas A, Yen T-Y, Kebebew E, Macher BA: Cell Surface and Secreted Protein Profiles of Human Thyroid Cancer Cell Lines Reveal Distinct Glycoprotein Patterns. Journal of Proteome Research 2009, 8:3958-3968.
63Cao J, Shen C, Wang H, Shen H, Chen Y, Nie A, Yan G, Lu H, Liu Y, Yang P: Identification of N-Glycosylation Sites on Secreted Proteins of Human Hepatocellular Carcinoma Cells with a Complementary Proteomics Approach. Journal of Proteome Research 2009, 8:662-672.
64Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res 2009, 8:651-661.
67McDonald CA, Yang JY, Marathe V, Yen T-Y, Macher BA: Combining Results from Lectin Affinity Chromatography and Glycocapture Approaches Substantially Improves the Coverage of the Glycoproteome. Molecular & Cellular Proteomics 2009, 8:287-301.
72Hanson SR, Hsu T-L, Weerapana E, Kishikawa K, Simon GM, Cravatt BF, Wong C-H: Tailored glycoproteomics and glycan site mapping using saccharide-selective bioorthogonal probes. Journal of the American Chemical Society 2007, 129:7266-+.
75Sun B, Ranish JA, Utleg AG, White JT, Yan X, Lin B, Hood L: Shotgun glycopeptide capture approach coupled with mass Spectrometry for comprehensive glycoproteomics. Molecular & Cellular Proteomics 2007, 6:141-149.
81Liu T, Qian WJ, Gritsenko MA, Camp DG, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. Journal of Proteome Research 2005, 4:2070-2080.