Contains      

UniProtKB-P11047

Protein Laminin subunit gamma-1
Gene LAMC1
Status Reviewed
Source 22Rv1 cell line (prostate cancer); 22Rv1 cell xenograft (prostate cancer); Bladder stromal cell line; Bladder tumor; Breast Cancer cell lines; Breast cancer xenografts; Breast cell lines; Breast tumor; Colorectal cancer cell line, HCT-116 (colorectal cancer); Colorectal tumor; DLBCL cell lines (Diffuse large B-cell lymphoma); DRO-1 Cell Line (Thyroid Cance); FTC-133 Cell Line (Thyroid Cance); HCC cell lines (Liver); HCCLM3 cell line (Liver); HEK293 cell line (embryonic kidney); HEK293T cell line (embryonic kidney); HeLa cell line (Cervical cancer); Hela cell line (cervical cancer); HepG2 cell line (Liver); HuH-7 cell line (Liver); IGROV-1/CP cell line (Ovarian cancer)IGROV-1/CP; LNCap/PC3 cell lines (Prostate cancer); Liver; Liver tumor (HCC); LnCap cell line (Prostate cancer); Non-small Cell Lung Carcinoma; OVCAR-3 cell line (Ovarian cancer); Ovarian cancer cell lines; Ovarian tumor; Pancreatic islets; Plasma; Platelet; Prostate; Prostate cancer metastasis to liver; Prostate stromal cell line; Prostate tumor; SKOV-3 cell line (Ovarian cancer); SW1990 cell line (Pancreatic cancer); Serum; Spermatozoa; TPC-1 Cell Line (Thyroid Cance); Urine; XTC-1 Cell Line (Thyroid Cance); hepatocarcinoma ascites syngeneic cell lines (Liver); ovarian tumor
Years 2003-20072007

Glycosites

Site Identified Peptides Year(Publication ID)
134 nLTLHLGK 2015(1);
134 SInLTLHLGK 2015(unpublished);
134 LAGVQYPSSInLTLHLGK 2015(unpublished);
576 nLSFSFR 2015(1);
576 QnLSFSFR 2014(33);
576 SYGQnLSF 2014(33);
576 GQnLSFSFR 2014(33); 2015(unpublished);
576 SYGQnLSFSF 2014(33);
576 QVLSYGQnLSF 2014(33);
576 SYGQnLSFSFR 2014(33);
576 VISYGQnISFSFR 2013(37);
576 QVLSYGQnLSFSFR 2007(75); 2012(52); 2014(14); 2014(33); 2015(1); 2015(2); 2015(unpublished);2015(unpublished);2015;2007;2007;
650 IINnITSIK 2014(16);
650 LLNnLTSIK 2003( 83); 2007(75); 2007(62); 2009(62); 2009(62); 2009(62); 2009(64); 2009(65); 2009(65); 2009(54); 2011(55); 2011(57); 2011(3); 2012(48); 2012(50); 2012(52); 2012(34); 2013(34); 2013(34); 2013(40); 2013(14); 2014(15); 2014(17); 2014(18); 2014(19); 2014(22); 2014(33); 2014(1); 2015(2); 2015(12); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015;2015;2015;2007;2007;2007;2007;
650 LLNnLTSIKIR 2014(33);
650 NnLTSIKIRGTY 2014(33);
650 FQKIINnITSIKI 2013(37);
650 LNnLTSIKIRGTY 2014(33);
650 EFQKLLNnLTSIKIRGTY 2014(33);
1022 NYFYnR 2014(33);
1022 EENYFYnR 2014(33);
1022 CDQCEENYFYnR 2011(54); 2012(52); 2013(34); 2013(40); 2014(14); 2014(16); 2014(22); 2014(32); 2014(32); 2014(33); 2015(unpublished);2015(unpublished);2007(unpublished);2007;2007;
1022 EENYFYnRSWPGC 2013(37);
1022 FYnRSWPGCQECPACY 2014(33);
1022 EGFVGNRCDQCEENYFYnR 2014(18);
1022 EGFVGNRCDQCEENYFYnRSWPGCQECPACYR 2013(38);
1107 VnNTISSQISR 2014(16);
1107 VnNTLSSQISR 2005( 81); 2007(75); 2007(62); 2009(62); 2009(62); 2009(63); 2009(64); 2009(65); 2009(65); 2009(54); 2011(55); 2011(57); 2011(58); 2011(3); 2012(47); 2012(48); 2012(52); 2012(34); 2013(34); 2013(34); 2013(40); 2013(14); 2014(15); 2014(17); 2014(19); 2014(22); 2014(33); 2014(1); 2015(2); 2015(12); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015;2007;2007;2007;2007;2007;2007;
1107 DRIQRVnNTISSQ 2013(37);
1107 LQRVnNTLSSQISR 2011(57); 2013(34); 2013(34); 2014(14); 2014(33); 2015(unpublished);2015(unpublished);2015(12);
1161 VAAAnVSVTQPE 2014(33);
1161 VAAAnVSVTQPESTGD 2007(75);
1161 VAAAnVSVTQPESTGDPNNMTIIAEEAR 2014(32); 2014(32);
1161 VAAAnVSVTQPESTGDPNNMTLLAEEAR 2005( 81); 2007(75); 2009(62); 2009(62); 2009(62); 2011(54); 2011(57); 2012(48); 2012(50); 2012(52); 2013(34); 2013(34); 2013(38); 2013(38); 2013(40); 2014(14); 2014(18); 2014(22); 2014(33); 2015(1); 2015(2); 2015(12); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(UnpublishedUnpublished ); 2015;2007;2007;2007;2007;20072007 ;
1161 VAAAnVSVTQPESTGDPNNMTLLAEEARK 2007(75); 2011(57); 2012(52); 2013(34); 2013(34); 2013(38); 2013(38); 2014(18); 2015(1); 2015(12);
1161 AKVAAAnVSVTQPESTGDPNNMTLLAEEAR 2014(18);
1161 AKVAAAnVSVTQPESTGDPNNMTLLAEEARK 2014(18);
1161 ELEKAKVAAAnVSVTQPESTGDPNNMTLLAEEAR 2014(18);
1175 nMTLLAEEAR 2014(33); 2015(1);
1175 PNnMTLLAEEAR 2014(14);
1175 STGDPNnMTLLAEE 2014(33);
1175 STGDPNnMTLLAEEAR 2014(33);
1175 VAAANVSVTQPESTGDPNnMTIIAEEAR 2014(32); 2014(32);
1175 VAAANVSVTQPESTGDPNnMTLLAEEAR 2005( 81); 2007(75); 2009(62); 2009(62); 2009(62); 2011(54); 2011(57); 2012(48); 2012(50); 2012(52); 2013(34); 2013(34); 2013(38); 2013(38); 2013(40); 2014(14); 2014(18); 2014(22); 2014(33); 2015(1); 2015(2); 2015(12); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(UnpublishedUnpublished ); 2015;2007;2007;2007;2007;20072007 ;
1175 VAAANVSVTQPESTGDPNnMTLLAEEARK 2007(75); 2011(57); 2012(52); 2013(34); 2013(34); 2013(38); 2013(38); 2014(18); 2015(1); 2015(12);
1175 AKVAAANVSVTQPESTGDPNnMTLLAEEAR 2014(18);
1175 AKVAAANVSVTQPESTGDPNnMTLLAEEARK 2014(18);
1175 ELEKAKVAAANVSVTQPESTGDPNnMTLLAEEAR 2014(18);
1205 KTAnDTSTEAY 2014(33);
1205 RVAKTAnDTSTEA 2013(37);
1205 TAnDTSTEAYNIIIR 2014(16); 2014(32); 2014(32);
1205 TAnDTSTEAYNLLLR 2009(62); 2009(62); 2009(62); 2009(62); 2009(63); 2009(65); 2009(65); 2009(67); 2011(54); 2011(55); 2011(58); 2012(50); 2012(50); 2012(52); 2013(34); 2013(34); 2013(34); 2013(38); 2013(38); 2013(40); 2014(14); 2014(15); 2014(18); 2014(22); 2014(33); 2015(1); 2015(2); 2015(12); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(UnpublishedUnpublished ); 2015;2007;2007;2007;2007;20072007 ;
1205 VAKTAnDTSTEAYNLLLR 2014(18); 2014(33);
1205 AERHKQEADDIVRVAKTAnDTSTEAY 2014(33);
1205 TAnDTSTEAYNLLLRTLAGENQTAFEIEELNRK 2013(38); 2013(38);
1223 RTLAGEnQTAF 2014(33);
1223 TLAGEnQTAFE 2014(33);
1223 LRTLAGEnQTAF 2014(33);
1223 nQTAFEIEELNR 2015(1);
1223 RTIAGEnQTAFEI 2013(37);
1223 AGEnQTAFEIEELNR 2014(33);
1223 NLLLRTLAGEnQTAF 2014(33);
1223 TIAGEnQTAFEIEEINR 2013(43); 2014(16); 2014(32); 2014(32);
1223 TLAGEnQTAFEIEELNR 2005( 81); 2009(62); 2009(62); 2009(62); 2009(62); 2009(63); 2012(50); 2012(50); 2012(52); 2013(34); 2013(34); 2013(34); 2013(38); 2013(38); 2013(40); 2014(14); 2014(17); 2014(18); 2014(22); 2014(33); 2015(1); 2015(2); 2015(12); 2015(unpublished);2015(unpublished);2015(unpublished);2015(UnpublishedUnpublished ); 2015;2015;2007;2007;2007;20072007 ;
1223 TLAGEnQTAFEIEELNRK 2011(57); 2013(34); 2013(34); 2013(34); 2013(38); 2013(38); 2014(33); 2015(unpublished);2015(1); 2015(unpublished);2015(2); 2015(unpublished);2015(unpublished);2015(unpublished);2015(12);
1223 TANDTSTEAYNLLLRTLAGEnQTAFEIEELNRK 2013(38); 2013(38);
1241 nISQDLEK 2013(40); 2014(14); 2014(22); 2014(33); 2015(unpublished);2015(1); 2015(2); 2015(unpublished);2015(10); 2015(12);
1241 nISQDLEKQAAR 2013(38); 2013(38); 2014(33);
1241 EQAKnISQDLEKQ 2014(33);
1241 KYEQAKnISQDIE 2013(37);
1241 YEQAKnISQDLEK 2012(50); 2013(34); 2013(34); 2013(34); 2013(38); 2013(38); 2014(14); 2014(15); 2014(33); 2015(1); 2015(unpublished);2015(unpublished);2015(unpublished);2015(12);
1241 KYEQAKnISQDLEK 2007(34); 2013(34); 2013(34); 2013(38); 2013(14); 2014(18); 2014(33); 2014(2); 2015(12); 2015(unpublished);2015(unpublished);2015;2007;2007;
1241 NRKYEQAKnISQDL 2009(64);
1241 YEQAKnISQDLEKQAAR 2013(38);
1380 nKTAAEEALR 2015(1);
1380 DRRVNDnKTAAEE 2013(37);
1380 VNDnKTAAEEAIR 2014(16);
1380 VNDnKTAAEEALR 2007(75); 2007(34); 2013(34); 2013(34); 2013(38); 2013(38); 2013(14); 2014(15); 2014(17); 2014(18); 2014(22); 2014(29); 2014(33); 2014(1); 2015(2); 2015(12); 2015(unpublished);2015(unpublished);2015(unpublished);2015;2015;2007;2007;2007;
1380 RVNDnKTAAEEALR 2013(34); 2013(34); 2013(34); 2013(38); 2013(38); 2014(14); 2014(18); 2014(33); 2015(2); 2015(unpublished);2015(12);
1395 IPAInQTITE 2014(33);
1395 nQTITEANEK 2015(1);
1395 KIPAInQTITE 2014(33);
1395 AInQTITEANEK 2014(14); 2015(unpublished);
1395 nQTITEANEKTR 2015(1);
1395 PAInQTITEANEK 2012(48);
1395 RKIPAInQTITEA 2013(37);
1395 IPAInQTITEANEK 2007(75); 2007(62); 2009(62); 2009(63); 2009(64); 2009(54); 2011(55); 2011(57); 2011(47); 2012(48); 2012(52); 2012(34); 2013(34); 2013(38); 2013(38); 2013(40); 2013(14); 2014(22); 2014(33); 2014(1); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015;2007;2007;2007;2007;2007;
1395 KIPAInQTITEANEK 2005(81); 2007(75); 2009(62); 2009(62); 2009(62); 2009(64); 2012(3); 2012(48); 2012(50); 2012(50); 2012(52); 2013(34); 2013(34); 2013(34); 2013(43); 2014(14); 2014(15); 2014(16); 2014(17); 2014(22); 2014(33); 2015(unpublished);2015(1); 2015(unpublished);2015(2); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(12);
1395 KIPAInQTITEANEKTR 2011(58); 2014(33); 2015(12);
1395 RKIPAInQTITEANEKTR 2014(33);
1395 RKIPAInQTITEANEKTREAQ 2014(33);
1395 RKIPAInQTITEANEKTREAQQAL 2014(33);
1439 nATSTKAEAER 2014(33);
1439 SAVQKnATSTK 2014(14);
1439 ASAVQKnATSTKA 2013(37);
1439 IASAVQKnATSTK 2013(34); 2013(34); 2013(34); 2014(14); 2014(15); 2014(33); 2015(unpublished);2015(2); 2015(unpublished);
1439 IASAVQKnATSTKAEAER 2013(34); 2014(18); 2015(12); 2015(unpublished);2007;

Sequence

1112131415161718191
MRGSHRAAPALRPRGRLWPVLAVLAAAAAAGCAQAAMDECTDEGGRPQRCMPEFVNAAFNVTVVATNTCGTPPEEYCVQTGVTGVTKSCHLCDAGQPHLQ
101111121131141151161171181191
HGAAFLTDYNNQADTTWWQSQTMLAGVQYPSSINLTLHLGKAFDITYVRLKFHTSRPESFAIYKRTREDGPWIPYQYYSGSCENTYSKANRGFIRTGGDE
201211221231241251261271281291
QQALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVLQEWVTATDIRVTLNRLNTFGDEVFNDPKVLKSYYYAISDFAVGGRCKCNGHASECMKNEF
301311321331341351361371381391
DKLVCNCKHNTYGVDCEKCLPFFNDRPWRRATAESASECLPCDCNGRSQECYFDPELYRSTGHGGHCTNCQDNTDGAHCERCRENFFRLGNNEACSSCHC
401411421431441451461471481491
SPVGSLSTQCDSYGRCSCKPGVMGDKCDRCQPGFHSLTEAGCRPCSCDPSGSIDECNIETGRCVCKDNVEGFNCERCKPGFFNLESSNPRGCTPCFCFGH
501511521531541551561571581591
SSVCTNAVGYSVYSISSTFQIDEDGWRAEQRDGSEASLEWSSERQDIAVISDSYFPRYFIAPAKFLGKQVLSYGQNLSFSFRVDRRDTRLSAEDLVLEGA
601611621631641651661671681691
GLRVSVPLIAQGNSYPSETTVKYVFRLHEATDYPWRPALTPFEFQKLLNNLTSIKIRGTYSERSAGYLDDVTLASARPGPGVPATWVESCTCPVGYGGQF
701711721731741751761771781791
CEMCLSGYRRETPNLGPYSPCVLCACNGHSETCDPETGVCNCRDNTAGPHCEKCSDGYYGDSTAGTSSDCQPCPCPGGSSCAVVPKTKEVVCTNCPTGTT
801811821831841851861871881891
GKRCELCDDGYFGDPLGRNGPVRLCRLCQCSDNIDPNAVGNCNRLTGECLKCIYNTAGFYCDRCKDGFFGNPLAPNPADKCKACNCNLYGTMKQQSSCNP
901911921931941951961971981991
VTGQCECLPHVTGQDCGACDPGFYNLQSGQGCERCDCHALGSTNGQCDIRTGQCECQPGITGQHCERCEVNHFGFGPEGCKPCDCHPEGSLSLQCKDDGR
1001101110211031104110511061107110811091
CECREGFVGNRCDQCEENYFYNRSWPGCQECPACYRLVKDKVADHRVKLQELESLIANLGTGDEMVTDQAFEDRLKEAEREVMDLLREAQDVKDVDQNLM
1101111111211131114111511161117111811191
DRLQRVNNTLSSQISRLQNIRNTIEETGNLAEQARAHVENTERLIEIASRELEKAKVAAANVSVTQPESTGDPNNMTLLAEEARKLAERHKQEADDIVRV
1201121112211231124112511261127112811291
AKTANDTSTEAYNLLLRTLAGENQTAFEIEELNRKYEQAKNISQDLEKQAARVHEEAKRAGDKAVEIYASVAQLSPLDSETLENEANNIKMEAENLEQLI
1301131113211331134113511361137113811391
DQKLKDYEDLREDMRGKELEVKNLLEKGKTEQQTADQLLARADAAKALAEEAAKKGRDTLQEANDILNNLKDFDRRVNDNKTAAEEALRKIPAINQTITE
1401141114211431144114511461147114811491
ANEKTREAQQALGSAAADATEAKNKAHEAERIASAVQKNATSTKAEAERTFAEVTDLDNEVNNMLKQLQEAEKELKRKQDDADQDMMMAGMASQAAQEAE
1501151115211531154115511561157115811591
INARKAKNSVTSLLSIINDLLEQLGQLDTVDLNKLNEIEGTLNKAKDEMKVSDLDRKVSDLENEAKKQEAAIMDYNRDIEEIMKDIRNLEDIRKTLPSGC
1601
FNTPSIEKP

Reference

ID Publication
1Sun S, Shah P, Eshghi ST, Yang W, Trikannad N, Yang S, Chen L, Aiyetan P, Hoti N, Zhang Z, et al: Comprehensive analysis of protein glycosylation by solid-phase extraction of N-linked glycans and glycosite-containing peptides. Nat Biotech 2015, advance online publication.
2Shah P, Wang X, Yang W, Eshghi ST, Sun S, Hoti N, Chen L, Yang S, Pasay J, Rubin A: Integrated Proteomic and Glycoproteomic Analyses of Prostate Cancer Cells Reveal Glycoprotein Alteration in Protein Abundance and Glycosylation. Molecular & Cellular Proteomics 2015, 14:2753-2763.
3Tian Y, Almaraz RT, Choi CH, Li QK, Saeui C, Li D, Shah P, Bhattacharya R, Yarema KJ, Zhang H: Identification of sialylated glycoproteins from metabolically oligosaccharide engineered pancreatic cells. Clinical proteomics 2015, 12:11.
10Tan ZJ, Yin HD, Nie S, Lin ZX, Zhu JH, Ruffin MT, Anderson MA, Simone DM, Lubman DM: Large-Scale Identification of Core-Fucosylated Glycopeptide Sites in Pancreatic Cancer Serum Using Mass Spectrometry. Journal of Proteome Research 2015, 14:1968-1978.
12Weng Y, Sui Z, Jiang H, Shan Y, Chen L, Zhang S, Zhang L, Zhang Y: Releasing N-glycan from Peptide N-terminus by N-terminal Succinylation Assisted Enzymatic Deglycosylation. Scientific Reports 2015, 5.
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
15Chen R, Seebun D, Ye M, Zou H, Figeys D: Site-specific characterization of cell membrane N-glycosylation with integrated hydrophilic interaction chromatography solid phase extraction and LC-MS/MS. Journal of Proteomics 2014, 103:194-203.
16Deeb SJ, Cox J, Schmidt-Supprian M, Mann M: N-linked Glycosylation Enrichment for In-depth Cell Surface Proteomics of Diffuse Large B-cell Lymphoma Subtypes. Molecular & Cellular Proteomics 2014, 13:240-251.
17Fang C, Xiong Z, Qin H, Huang G, Liu J, Ye M, Feng S, Zou H: One-pot synthesis of magnetic colloidal nanocrystal clusters coated with chitosan for selective enrichment of glycopeptides. Analytica Chimica Acta 2014, 841:99-105.
18Hirao Y, Matsuzaki H, Iwaki J, Kuno A, Kaji H, Ohkura T, Togayachi A, Abe M, Nomura M, Noguchi M, et al: Glycoproteomics Approach for Identifying Glycobiomarker Candidate Molecules for Tissue Type Classification of Non-small Cell Lung Carcinoma. Journal of Proteome Research 2014, 13:4705-4716.
19Huang G, Sun Z, Qin H, Zhao L, Xiong Z, Peng X, Ou J, Zou H: Preparation of hydrazine functionalized polymer brushes hybrid magnetic nanoparticles for highly specific enrichment of glycopeptides. Analyst 2014, 139:2199-2206.
22Nicastri A, Gaspari M, Sacco R, Elia L, Gabriele C, Romano R, Rizzuto A, Cuda G: N-Glycoprotein Analysis Discovers New Up-Regulated Glycoproteins in Colorectal Cancer Tissue. Journal of Proteome Research 2014, 13:4932-4941.
29Weng Y, Qu Y, Jiang H, Wu Q, Zhang L, Yuan H, Zhou Y, Zhang X, Zhang Y: An integrated sample pretreatment platform for quantitative N-glycoproteome analysis with combination of on-line glycopeptide enrichment, deglycosylation and dimethyl labeling. Analytica Chimica Acta 2014, 833:1-8.
32Zhang Z, Sun Z, Zhu J, Liu J, Huang G, Ye M, Zou H: High-Throughput Determination of the Site-Specific N-Sialoglycan Occupancy Rates by Differential Oxidation of Glycoproteins Followed with Quantitative Glycoproteomics Analysis. Analytical Chemistry 2014, 86:9830-9837.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
34Sun S, Zhang B, Aiyetan P, Zhou J-Y, Shah P, Yang W, Levine DA, Zhang Z, Chan DW, Zhang H: Analysis of N-glycoproteins using Genomic N-glycosite Prediction. Journal of Proteome Research 2013, 12:5609-5615.
37Boersema PJ, Geiger T, Wisniewski JR, Mann M: Quantification of the N-glycosylated Secretome by Super-SILAC During Breast Cancer Progression and in Human Blood Samples. Molecular & Cellular Proteomics 2013, 12:158-171.
38Kaji H, Ocho M, Togayachi A, Kuno A, Sogabe M, Ohkura T, Nozaki H, Angata T, Chiba Y, Ozaki H, et al: Glycoproteomic Discovery of Serological Biomarker Candidates for HCV/HBV Infection-Associated Liver Fibrosis and Hepatocellular Carcinoma. Journal of Proteome Research 2013, 12:2630-2640.
40Li X, Jiang J, Zhao X, Wang J, Han H, Zhao Y, Peng B, Zhong R, Ying W, Qian X: N-glycoproteome Analysis of the Secretome of Human Metastatic Hepatocellular Carcinoma Cell Lines Combining Hydrazide Chemistry, HILIC Enrichment and Mass Spectrometry. Plos One 2013, 8.
43Wang GG, Wu YB, Zhou T, Guo YS, Zheng B, Wang J, Bi Y, Liu FJ, Zhou ZM, Guo XJ, Sha JH: Mapping of the N-Linked Glycoproteome of Human Spermatozoa. Journal of Proteome Research 2013, 12:5750-5759.
47Almaraz RT, Tian Y, Bhattarcharya R, Tan E, Chen S-H, Dallas MR, Chen L, Zhang Z, Zhang H, Konstantopoulos K: Metabolic flux increases glycoprotein sialylation: implications for cell adhesion and cancer metastasis. Molecular & Cellular Proteomics 2012, 11:M112. 017558.
48Danzer C, Eckhardt K, Schmidt A, Fankhauser N, Ribrioux S, Wollscheid B, Mueller L, Schiess R, Zuellig R, Lehmann R, et al: Comprehensive Description of the N-Glycoproteome of Mouse Pancreatic beta-Cells and Human Islets. Journal of Proteome Research 2012, 11:1598-1608.
50Whitmore TE, Peterson A, Holzman T, Eastham A, Amon L, McIntosh M, Ozinsky A, Nelson PS, Martin DB: Integrative Analysis of N-Linked Human Glycoproteomic Data Sets Reveals PTPRF Ectodomain as a Novel Plasma Biomarker Candidate for Prostate Cancer. Journal of Proteome Research 2012, 11:2653-2665.
52Yen T-Y, Macher BA, McDonald CA, Alleyne-Chin C, Timpe LC: Glycoprotein Profiles of Human Breast Cells Demonstrate a Clear Clustering of Normal/Benign versus Malignant Cell Lines and Basal versus Luminal Cell Lines. Journal of Proteome Research 2012, 11:656-667.
54Tian Y, Yao Z, Roden R, Zhang H: Identification of glycoproteins associated with different histological subtypes of ovarian tumors using quantitative glycoproteomics. Proteomics 2011, 11:4677-4687.
55Tian Y, Bova GS, Zhang H: Quantitative glycoproteomic analysis of optimal cutting temperature-embedded frozen tissues identifying glycoproteins associated with aggressive prostate cancer. Analytical chemistry 2011, 83:7013-7019.
57Chen Y, Cao J, Yan G, Lu H, Yang P: Two-step protease digestion and glycopeptide capture approach for accurate glycosite identification and glycoprotein sequence coverage improvement. Talanta 2011, 85:70-75.
58Nagano K, Shinkawa T, Kato K, Inomata N, Yabuki N, Haramura M: Distinct cell surface proteome profiling by biotin labeling and glycoprotein capturing. Journal of Proteomics 2011, 74:1985-1993.
62Arcinas A, Yen T-Y, Kebebew E, Macher BA: Cell Surface and Secreted Protein Profiles of Human Thyroid Cancer Cell Lines Reveal Distinct Glycoprotein Patterns. Journal of Proteome Research 2009, 8:3958-3968.
63Cao J, Shen C, Wang H, Shen H, Chen Y, Nie A, Yan G, Lu H, Liu Y, Yang P: Identification of N-Glycosylation Sites on Secreted Proteins of Human Hepatocellular Carcinoma Cells with a Complementary Proteomics Approach. Journal of Proteome Research 2009, 8:662-672.
64Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res 2009, 8:651-661.
65Goo YA, Lilu AY, Ryu S, Shaffer SA, Malmstrom L, Page L, Nguyen LT, Doneanu CE, Goodlett DR: Identification of Secreted Glycoproteins of Human Prostate and Bladder Stromal Cells by Comparative Quantitative Proteomics. Prostate 2009, 69:49-61.
67McDonald CA, Yang JY, Marathe V, Yen T-Y, Macher BA: Combining Results from Lectin Affinity Chromatography and Glycocapture Approaches Substantially Improves the Coverage of the Glycoproteome. Molecular & Cellular Proteomics 2009, 8:287-301.
75Sun B, Ranish JA, Utleg AG, White JT, Yan X, Lin B, Hood L: Shotgun glycopeptide capture approach coupled with mass Spectrometry for comprehensive glycoproteomics. Molecular & Cellular Proteomics 2007, 6:141-149.
81Liu T, Qian WJ, Gritsenko MA, Camp DG, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. Journal of Proteome Research 2005, 4:2070-2080.