Contains      

UniProtKB-P12109

Protein Collagen alpha-1(VI) chain
Gene COL6A1
Status Reviewed
Source Breast Cancer cell lines; Breast cancer xenografts; Breast cell lines; Breast tumor; Colorectal cancer cell line, HCT-116 (colorectal cancer); Colorectal tumor; HCC cell lines (Liver); HCCLM3 cell line (Liver); HEK293T cell line (embryonic kidney); LNCap/PC3 cell lines (Prostate cancer); Liver; Liver tumor (HCC); Non-small Cell Lung Carcinoma; Ovarian tumor; Pancreatic islets; Prostate; Prostate tumor; Serum; Urine
Years 2007-2015

Glycosites

Site Identified Peptides Year(Publication ID)
212 nFTAADW 2014(33);
212 RnFTAADW 2014(33);
212 nFTAADWGQ 2014(33);
212 RRnFTAADW 2014(33);
212 RnFTAADWGQ 2012(48); 2014(33);
212 nFTAADWGQSR 2007(63); 2009(64); 2009(55); 2011(57); 2011(58); 2011(48); 2012(52); 2012(34); 2013(40); 2013(45); 2013(18); 2014(19); 2014(22); 2014(33); 2014(2); 2015(unpublished);2015(unpublished);2015(unpublished);2015;2015;2015;2007;2007;2007;
212 RnFTAADWGQSR 2009(64); 2011(55); 2011(57); 2012(3); 2012(48); 2013(34); 2013(45); 2014(22); 2014(32); 2014(32); 2014(33); 2015(unpublished);2015(2); 2015(unpublished);2015(unpublished);
212 DHTYRRnFTAADW 2013(37);
212 LSIIATDHTYRRnFTAADWGQSR 2014(33);
212 nFTAADWGQSRDAEEAISQTIDTIVDMIK 2009(64);
516 GEDGPAGnGTE 2014(33);
516 RGEDGPAGnGTE 2014(33);
516 RGEDGPAGnGTEGF 2009(64);
516 MGERGEDGPAGnGTEGF 2009(64);
516 GEDGPAGnGTEGFPGFPGYPGNR 2014(33); 2007(unpublished);2007(unpublished);
516 RGEDGPAGnGTEGFPGFPGYPGNR 2014(33);
516 GAPGPAGPPGDPGLMGERGEDGPAGnGTE 2014(33);
537 PGInGTK 2014(33);
537 GAPGInGTK 2013(40); 2014(33); 2015(unpublished);
537 RGAPGInGTKGYP 2013(37);
804 LKnVTAQI 2014(33);
804 LKnVTAQIC 2014(33);
804 nVTAQICIDK 2007(63); 2009(64); 2009(40); 2013(45); 2013(22); 2014(33); 2014(unpublished);2015(unpublished);2015(unpublished);2007(unpublished);2007;2007;2007;
804 nVTAQICIDKK 2009(64); 2013(45); 2014(33); 2015(unpublished);2015(unpublished);2015(unpublished);
804 EDAFIKnVTAQIC 2013(37);
804 AELLEDAFLKnVTAQ 2014(33);
804 DAFLKnVTAQICIDK 2014(33);
804 DAFLKnVTAQICIDKK 2014(33);
804 ENYAELLEDAFLKnVTAQ 2015(unpublished);
804 ENYAELLEDAFLKnVTAQICIDK 2009(64); 2014(33); 2015(unpublished);2015(10);
804 ENYAELLEDAFLKnVTAQICIDKK 2009(64); 2014(33);
896 ASLQFLQnY 2014(33);
896 ASLQFLQnYTA 2014(33);
896 ASLQFLQnYTAL 2007(33); 2014(unpublished);2007(unpublished);2007;
896 ASLQFLQnYTALA 2014(33);
896 ASLQFLQnYTALAS 2012(48); 2014(33);
896 ASLQFLQnYTALASA 2014(33);
896 ASLQFLQnYTALASAV 2014(14); 2014(33); 2015(unpublished);
896 ASLQFLQnYTALASAVDA 2014(14); 2014(33); 2015(unpublished);
896 ASLQFLQnYTALASAVDAM 2014(33);
896 LQFLQnYTALASAVDAMDFINDATDVNDALGYVTR 2015(unpublished);
896 ASLQFLQnYTALASAVDAMDFINDATDVNDALGYVTR 2009(64); 2013(45); 2014(33); 2015(unpublished);2015(2);

Sequence

1112131415161718191
MRAARALLPLLLQACWTAAQDEPETPRAVAFQDCPVDLFFVLDTSESVALRLKPYGALVDKVKSFTKRFIDNLRDRYYRCDRNLVWNAGALHYSDEVEII
101111121131141151161171181191
QGLTRMPGGRDALKSSVDAVKYFGKGTYTDCAIKKGLEQLLVGGSHLKENKYLIVVTDGHPLEGYKEPCGGLEDAVNEAKHLGVKVFSVAITPDHLEPRL
201211221231241251261271281291
SIIATDHTYRRNFTAADWGQSRDAEEAISQTIDTIVDMIKNNVEQVCCSFECQPARGPPGLRGDPGFEGERGKPGLPGEKGEAGDPGRPGDLGPVGYQGM
301311321331341351361371381391
KGEKGSRGEKGSRGPKGYKGEKGKRGIDGVDGVKGEMGYPGLPGCKGSPGFDGIQGPPGPKGDPGAFGLKGEKGEPGADGEAGRPGSSGPSGDEGQPGEP
401411421431441451461471481491
GPPGEKGEAGDEGNPGPDGAPGERGGPGERGPRGTPGTRGPRGDPGEAGPQGDQGREGPVGVPGDPGEAGPIGPKGYRGDEGPPGSEGARGAPGPAGPPG
501511521531541551561571581591
DPGLMGERGEDGPAGNGTEGFPGFPGYPGNRGAPGINGTKGYPGLKGDEGEAGDPGDDNNDIAPRGVKGAKGYRGPEGPQGPPGHQGPPGPDECEILDII
601611621631641651661671681691
MKMCSCCECKCGPIDLLFVLDSSESIGLQNFEIAKDFVVKVIDRLSRDELVKFEPGQSYAGVVQYSHSQMQEHVSLRSPSIRNVQELKEAIKSLQWMAGG
701711721731741751761771781791
TFTGEALQYTRDQLLPPSPNNRIALVITDGRSDTQRDTTPLNVLCSPGIQVVSVGIKDVFDFIPGSDQLNVISCQGLAPSQGRPGLSLVKENYAELLEDA
801811821831841851861871881891
FLKNVTAQICIDKKCPDYTCPITFSSPADITILLDGSASVGSHNFDTTKRFAKRLAERFLTAGRTDPAHDVRVAVVQYSGTGQQRPERASLQFLQNYTAL
901911921931941951961971981991
ASAVDAMDFINDATDVNDALGYVTRFYREASSGAAKKRLLLFSDGNSQGATPAAIEKAVQEAQRAGIEIFVVVVGRQVNEPHIRVLVTGKTAEYDVAYGE
100110111021
SHLFRVPSYQALLRGVFHQTVSRKVALG

Reference

ID Publication
2Shah P, Wang X, Yang W, Eshghi ST, Sun S, Hoti N, Chen L, Yang S, Pasay J, Rubin A: Integrated Proteomic and Glycoproteomic Analyses of Prostate Cancer Cells Reveal Glycoprotein Alteration in Protein Abundance and Glycosylation. Molecular & Cellular Proteomics 2015, 14:2753-2763.
3Tian Y, Almaraz RT, Choi CH, Li QK, Saeui C, Li D, Shah P, Bhattacharya R, Yarema KJ, Zhang H: Identification of sialylated glycoproteins from metabolically oligosaccharide engineered pancreatic cells. Clinical proteomics 2015, 12:11.
10Tan ZJ, Yin HD, Nie S, Lin ZX, Zhu JH, Ruffin MT, Anderson MA, Simone DM, Lubman DM: Large-Scale Identification of Core-Fucosylated Glycopeptide Sites in Pancreatic Cancer Serum Using Mass Spectrometry. Journal of Proteome Research 2015, 14:1968-1978.
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
18Hirao Y, Matsuzaki H, Iwaki J, Kuno A, Kaji H, Ohkura T, Togayachi A, Abe M, Nomura M, Noguchi M, et al: Glycoproteomics Approach for Identifying Glycobiomarker Candidate Molecules for Tissue Type Classification of Non-small Cell Lung Carcinoma. Journal of Proteome Research 2014, 13:4705-4716.
19Huang G, Sun Z, Qin H, Zhao L, Xiong Z, Peng X, Ou J, Zou H: Preparation of hydrazine functionalized polymer brushes hybrid magnetic nanoparticles for highly specific enrichment of glycopeptides. Analyst 2014, 139:2199-2206.
22Nicastri A, Gaspari M, Sacco R, Elia L, Gabriele C, Romano R, Rizzuto A, Cuda G: N-Glycoprotein Analysis Discovers New Up-Regulated Glycoproteins in Colorectal Cancer Tissue. Journal of Proteome Research 2014, 13:4932-4941.
32Zhang Z, Sun Z, Zhu J, Liu J, Huang G, Ye M, Zou H: High-Throughput Determination of the Site-Specific N-Sialoglycan Occupancy Rates by Differential Oxidation of Glycoproteins Followed with Quantitative Glycoproteomics Analysis. Analytical Chemistry 2014, 86:9830-9837.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
34Sun S, Zhang B, Aiyetan P, Zhou J-Y, Shah P, Yang W, Levine DA, Zhang Z, Chan DW, Zhang H: Analysis of N-glycoproteins using Genomic N-glycosite Prediction. Journal of Proteome Research 2013, 12:5609-5615.
37Boersema PJ, Geiger T, Wisniewski JR, Mann M: Quantification of the N-glycosylated Secretome by Super-SILAC During Breast Cancer Progression and in Human Blood Samples. Molecular & Cellular Proteomics 2013, 12:158-171.
40Li X, Jiang J, Zhao X, Wang J, Han H, Zhao Y, Peng B, Zhong R, Ying W, Qian X: N-glycoproteome Analysis of the Secretome of Human Metastatic Hepatocellular Carcinoma Cell Lines Combining Hydrazide Chemistry, HILIC Enrichment and Mass Spectrometry. Plos One 2013, 8.
45Zhou H, Froehlich JW, Briscoe AC, Lee RS: The GlycoFilter: A Simple and Comprehensive Sample Preparation Platform for Proteomics, N-Glycomics and Glycosylation Site Assignment. Molecular & Cellular Proteomics 2013, 12:2981-2991.
48Danzer C, Eckhardt K, Schmidt A, Fankhauser N, Ribrioux S, Wollscheid B, Mueller L, Schiess R, Zuellig R, Lehmann R, et al: Comprehensive Description of the N-Glycoproteome of Mouse Pancreatic beta-Cells and Human Islets. Journal of Proteome Research 2012, 11:1598-1608.
52Yen T-Y, Macher BA, McDonald CA, Alleyne-Chin C, Timpe LC: Glycoprotein Profiles of Human Breast Cells Demonstrate a Clear Clustering of Normal/Benign versus Malignant Cell Lines and Basal versus Luminal Cell Lines. Journal of Proteome Research 2012, 11:656-667.
55Tian Y, Bova GS, Zhang H: Quantitative glycoproteomic analysis of optimal cutting temperature-embedded frozen tissues identifying glycoproteins associated with aggressive prostate cancer. Analytical chemistry 2011, 83:7013-7019.
57Chen Y, Cao J, Yan G, Lu H, Yang P: Two-step protease digestion and glycopeptide capture approach for accurate glycosite identification and glycoprotein sequence coverage improvement. Talanta 2011, 85:70-75.
58Nagano K, Shinkawa T, Kato K, Inomata N, Yabuki N, Haramura M: Distinct cell surface proteome profiling by biotin labeling and glycoprotein capturing. Journal of Proteomics 2011, 74:1985-1993.
63Cao J, Shen C, Wang H, Shen H, Chen Y, Nie A, Yan G, Lu H, Liu Y, Yang P: Identification of N-Glycosylation Sites on Secreted Proteins of Human Hepatocellular Carcinoma Cells with a Complementary Proteomics Approach. Journal of Proteome Research 2009, 8:662-672.
64Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res 2009, 8:651-661.