Contains      

UniProtKB-P13284

Protein Gamma-interferon-inducible lysosomal thiol reductase
Gene IFI30
Status Reviewed
Source Breast Cancer cell lines; Breast cancer cell lines; Breast cancer xenografts; Breast cell lines; Breast tumor; DLBCL cell lines (Diffuse large B-cell lymphoma); K562A cell line (Leukemia); K562S cell line (Leukemia); Liver; Non-small Cell Lung Carcinoma; OVCAR-3 cell line (Ovarian cancer); Ovarian tumor; Prostate; Prostate cancer metastasis to liver; Prostate tumor; Urine; XTC-1 Cell Line (Thyroid Cance)
Years 2007-2015

Glycosites

Site Identified Peptides Year(Publication ID)
63 APLVnVTLY 2014(33);
63 NAPLVnVTLY 2014(33);
63 NAPLVnVTLYY 2014(33);
63 KSNAPLVnVTLY 2014(33);
63 NAPLVnVTLYYE 2014(33);
63 SNAPIVnVTIYYE 2013(37);
63 nVTLYYEALCGGCR 2015(1);
63 APLVnVTLYYEALCGGCR 2015(unpublished);2007(unpublished);2007(unpublished);2007(unpublished);2007(Unpublished ); 2007 ;
63 NAPLVnVTLYYEALCGGCR 2007(unpublished);2015(unpublished);
63 SNAPIVnVTIYYEAICGGCR 2014(16);
63 SNAPLVnVTLYYEALCGGCR 2009(62); 2012(52); 2014(18); 2015(unpublished);2015(unpublished);
63 KSNAPIVnVTIYYEAICGGCR 2014(16);
63 NAPLVnVTLYYEALCGGCRAF 2014(33);
95 nVTLVPY 2014(33);
95 ILnVTLVPY 2014(33);
95 ILnVTLVPYG 2014(33);
95 nVTLVPYGNAQEQ 2015(1);
95 ILnVTLVPYGNAQE 2014(33);
95 ELFPTWLLVMEILnV 2007(unpublished);
95 ILnVTLVPYGNAQEQNVSGR 2014(33);
95 EILnVTLVPYGNAQEQNVSGR 2015(unpublished);
95 LVMEILnVTLVPYGNAQEQNVSGR 2015(unpublished);
95 ELFPTWLLVMEILnVTLVPYGNAQEQNVSGR 2012(52); 2014(25); 2014(25); 2015(1);
108 AQEQnVSGR 2014(14); 2015(unpublished);
108 AQEQnVSGRW 2014(33);
108 GNAQEQnVSGR 2014(33); 2015(unpublished);2015(unpublished);2007(unpublished);2007;2007;
108 GNAQEQnVSGRW 2014(33);
108 GNAQEQnVSGRWEF 2014(33);
108 TLVPYGNAQEQnVSGR 2014(14); 2015(unpublished);
108 ILNVTLVPYGNAQEQnVSGR 2014(33);
108 EILNVTLVPYGNAQEQnVSGR 2015(unpublished);
108 LVMEILNVTLVPYGNAQEQnVSGR 2015(unpublished);
108 ELFPTWLLVMEILNVTLVPYGNAQEQnVSGR 2012(52); 2014(25); 2014(25); 2015(1);

Sequence

1112131415161718191
MTLSPLLLFLPPLLLLLDVPTAAVQASPLQALDFFGNGPPVNYKTGNLYLRGPLKKSNAPLVNVTLYYEALCGGCRAFLIRELFPTWLLVMEILNVTLVP
101111121131141151161171181191
YGNAQEQNVSGRWEFKCQHGEEECKFNKVEACVLDELDMELAFLTIVCMEEFEDMERSLPLCLQLYAPGLSPDTIMECAMGDRGMQLMHANAQRTDALQP
201211221231241
PHEYVPWVTVNGKPLEDQTQLLTLVCQLYQGKKPDVCPSSTSSLRSVCFK

Reference

ID Publication
1Sun S, Shah P, Eshghi ST, Yang W, Trikannad N, Yang S, Chen L, Aiyetan P, Hoti N, Zhang Z, et al: Comprehensive analysis of protein glycosylation by solid-phase extraction of N-linked glycans and glycosite-containing peptides. Nat Biotech 2015, advance online publication.
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
16Deeb SJ, Cox J, Schmidt-Supprian M, Mann M: N-linked Glycosylation Enrichment for In-depth Cell Surface Proteomics of Diffuse Large B-cell Lymphoma Subtypes. Molecular & Cellular Proteomics 2014, 13:240-251.
18Hirao Y, Matsuzaki H, Iwaki J, Kuno A, Kaji H, Ohkura T, Togayachi A, Abe M, Nomura M, Noguchi M, et al: Glycoproteomics Approach for Identifying Glycobiomarker Candidate Molecules for Tissue Type Classification of Non-small Cell Lung Carcinoma. Journal of Proteome Research 2014, 13:4705-4716.
25Sun Z, Dong J, Zhang S, Hu Z, Cheng K, Li K, Xu B, Ye M, Nie Y, Fan D, Zou H: Identification of Chemoresistance-Related Cell-Surface Glycoproteins in Leukemia Cells and Functional Validation of Candidate Glycoproteins. Journal of Proteome Research 2014, 13:1593-1601.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
37Boersema PJ, Geiger T, Wisniewski JR, Mann M: Quantification of the N-glycosylated Secretome by Super-SILAC During Breast Cancer Progression and in Human Blood Samples. Molecular & Cellular Proteomics 2013, 12:158-171.
52Yen T-Y, Macher BA, McDonald CA, Alleyne-Chin C, Timpe LC: Glycoprotein Profiles of Human Breast Cells Demonstrate a Clear Clustering of Normal/Benign versus Malignant Cell Lines and Basal versus Luminal Cell Lines. Journal of Proteome Research 2012, 11:656-667.
62Arcinas A, Yen T-Y, Kebebew E, Macher BA: Cell Surface and Secreted Protein Profiles of Human Thyroid Cancer Cell Lines Reveal Distinct Glycoprotein Patterns. Journal of Proteome Research 2009, 8:3958-3968.