Contains      

UniProtKB-P13598

Protein Intercellular adhesion molecule 2
Gene ICAM2
Status Reviewed
Source Breast Cancer cell lines; Breast cell lines; Breast tumor; Cerebrospinal fluid; Colorectal tumor; DLBCL cell lines (Diffuse large B-cell lymphoma); HCC cell lines (Liver); HCCLM3 cell line (Liver); HuH-7 cell line (Liver); Human; Jurkat T cell line; K562A cell line (Leukemia); Liver; Liver tumor (HCC); Lymphocytes; Ovarian tumor; Plasma; PlasmaJurkat T cell line; Platelet; Platelet Plasma membranes; Prostate; Prostate tumor; SW1990 cell line (Pancreatic cancer); Serum; Serum (HCC); Urine; ovarian tumor; plasma; umbilical vein Endothelial Cells
Years 2005-2015

Glycosites

Site Identified Peptides Year(Publication ID)
47 GSLEVnCSTTCNQPEVGGLETSLDK 2012(52); 2013(44); 2013(45); 2013(45); 2014(13); 2014(13); 2014(22); 2014(25); 2014(33); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(10);
47 GSIEVnCSTTCNQPEVGGIETSIDKIIIDEQAQWK 2014(16);
82 HYLVSnISHD 2014(33);
82 LVSnISHDTVL 2014(33);
82 KHYIVSnISHDTV 2013(37);
82 LVSnISHDTVLQCHF 2014(33);
82 HYIVSnISHDTVIQCHFTCSGK 2014(16);
82 HYLVSnISHDTVLQCHFTCSGK 2007(38); 2013(45); 2013(45); 2013(13); 2014(35); 2014(33); 2014(8); 2015(10); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015;2007;2007;2007;2007;
82 HYIVSnISHDTVIQCHFTCSGKQESMNSNVSVYQPPR 2014(16);
105 QESMNSnVSVYQP 2013(37);
105 SMNSnVSVYQPPR 2014(33);
105 QESMNSnVSVYQPPR 2005( 81); 2007(74); 2007(40); 2010(54); 2011(52); 2012(40); 2013(44); 2013(45); 2013(13); 2014(13); 2014(14); 2014(16); 2014(22); 2014(25); 2014(32); 2014(32); 2014(33); 2014(10); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2007;2007;2007;2007;2007;2007;
105 TCSGKQESMNSnVSVY 2014(33);
105 HYIVSNISHDTVIQCHFTCSGKQESMNSnVSVYQPPR 2014(16);
153 GnETLHYE 2014(33);
153 GnETLHYETF 2014(33);
153 LFRGnETLHY 2014(33);
153 RGnETLHYETF 2014(33);
153 GnETIHYETFGK 2014(32);
153 GnETLHYETFGK 2005( 81); 2007(74); 2007(52); 2012(38); 2013(38); 2013(40); 2013(42); 2013(44); 2013(45); 2013(45); 2013(13); 2014(13); 2014(14); 2014(22); 2014(25); 2014(33); 2014(10); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015;2015;2007;2007;2007;2007;
153 IFIFRGnETIHYE 2013(37);
153 DSLTLFLFRGnETLHYETFG 2015(6);
153 VPTVEPIDSITIFIFRGnETIHYETFGK 2014(16);
153 VPTVEPLDSLTLFLFRGnETLHYETFGK 2015(unpublished);2015(unpublished);
176 ATATFnSTADRE 2013(42);
176 EATATFnSTADRE 2013(37);
176 AAPAPQEATATFnSTADR 2005( 81); 2007(74); 2007(63); 2009(40); 2010(54); 2011(47); 2012(40); 2013(44); 2013(45); 2013(13); 2014(13); 2014(14); 2014(22); 2014(24); 2014(25); 2014(32); 2014(33); 2014(4); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2007;2007;2007;2007;2007;2007;2007;
176 AAPAPQEATATFnSTADREDGHR 2013(45); 2014(13); 2014(13); 2014(32); 2014(33); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);
176 AAPAPQEATATFnSTADREDGHRNFSCIAVIDIMSR 2014(16);
176 AAPAPQEATATFnSTADREDGHRNFSCLAVLDLMSR 2015(unpublished);
187 nFSCLAVLDLMSR 2007(74); 2013(45); 2013(45); 2014(25);
187 EDGHRnFSCLAVLDLMSR 2013(45); 2015(unpublished);2015(unpublished);2015(unpublished);
187 AAPAPQEATATFNSTADREDGHRnFSCIAVIDIMSR 2014(16);
187 AAPAPQEATATFNSTADREDGHRnFSCLAVLDLMSR 2015(unpublished);

Sequence

1112131415161718191
MSSFGYRTLTVALFTLICCPGSDEKVFEVHVRPKKLAVEPKGSLEVNCSTTCNQPEVGGLETSLDKILLDEQAQWKHYLVSNISHDTVLQCHFTCSGKQE
101111121131141151161171181191
SMNSNVSVYQPPRQVILTLQPTLVAVGKSFTIECRVPTVEPLDSLTLFLFRGNETLHYETFGKAAPAPQEATATFNSTADREDGHRNFSCLAVLDLMSRG
201211221231241251261271
GNIFHKHSAPKMLEIYEPVSDSQMVIIVTVVSVLLSLFVTSVLLCFIFGQHLRQQRMGTYGVRAAWRRLPQAFRP

Reference

ID Publication
4Cheow ESH, Sim KH, de Kleijn D, Lee CN, Sorokin V, Sze SK: Simultaneous Enrichment of Plasma Soluble and Extracellular Vesicular Glycoproteins Using Prolonged Ultracentrifugation-Electrostatic Repulsion-hydrophilic Interaction Chromatography (PUC-ERLIC) Approach. Molecular & Cellular Proteomics 2015, 14:1657-1671.
6Kim DS, Hahn Y: The acquisition of novel N-glycosylation sites in conserved proteins during human evolution. Bmc Bioinformatics 2015, 16.
8Ma C, Zhang Q, Qu JY, Zhao XY, Li X, Liu YP, Wang PG: A precise approach in large scale core-fucosylated glycoprotein identification with low- and high-normalized collision energy. Journal of Proteomics 2015, 114:61-70.
10Tan ZJ, Yin HD, Nie S, Lin ZX, Zhu JH, Ruffin MT, Anderson MA, Simone DM, Lubman DM: Large-Scale Identification of Core-Fucosylated Glycopeptide Sites in Pancreatic Cancer Serum Using Mass Spectrometry. Journal of Proteome Research 2015, 14:1968-1978.
13Yang W, Laeyendecker O, Wendel SK, Zhang B, Sun S, Zhou J-Y, Ao M, Moore RD, Jackson JB, Zhang H: Glycoproteomic Study Reveals Altered Plasma Proteins Associated with HIV Elite Suppressors. Theranostics 2014, 4:1153.
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
16Deeb SJ, Cox J, Schmidt-Supprian M, Mann M: N-linked Glycosylation Enrichment for In-depth Cell Surface Proteomics of Diffuse Large B-cell Lymphoma Subtypes. Molecular & Cellular Proteomics 2014, 13:240-251.
22Nicastri A, Gaspari M, Sacco R, Elia L, Gabriele C, Romano R, Rizzuto A, Cuda G: N-Glycoprotein Analysis Discovers New Up-Regulated Glycoproteins in Colorectal Cancer Tissue. Journal of Proteome Research 2014, 13:4932-4941.
24Song E, Zhu R, Hammond ZT, Mechref Y: LC-MS/MS Quantitation of Esophagus Disease Blood Serum Glycoproteins by Enrichment with Hydrazide Chemistry and Lectin Affinity Chromatography. Journal of Proteome Research 2014, 13:4808-4820.
25Sun Z, Dong J, Zhang S, Hu Z, Cheng K, Li K, Xu B, Ye M, Nie Y, Fan D, Zou H: Identification of Chemoresistance-Related Cell-Surface Glycoproteins in Leukemia Cells and Functional Validation of Candidate Glycoproteins. Journal of Proteome Research 2014, 13:1593-1601.
32Zhang Z, Sun Z, Zhu J, Liu J, Huang G, Ye M, Zou H: High-Throughput Determination of the Site-Specific N-Sialoglycan Occupancy Rates by Differential Oxidation of Glycoproteins Followed with Quantitative Glycoproteomics Analysis. Analytical Chemistry 2014, 86:9830-9837.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
35Chen J, Shah P, Zhang H: Solid phase extraction of N-linked glycopeptides using hydrazide tip. Analytical chemistry 2013, 85:10670-10674.
37Boersema PJ, Geiger T, Wisniewski JR, Mann M: Quantification of the N-glycosylated Secretome by Super-SILAC During Breast Cancer Progression and in Human Blood Samples. Molecular & Cellular Proteomics 2013, 12:158-171.
38Kaji H, Ocho M, Togayachi A, Kuno A, Sogabe M, Ohkura T, Nozaki H, Angata T, Chiba Y, Ozaki H, et al: Glycoproteomic Discovery of Serological Biomarker Candidates for HCV/HBV Infection-Associated Liver Fibrosis and Hepatocellular Carcinoma. Journal of Proteome Research 2013, 12:2630-2640.
40Li X, Jiang J, Zhao X, Wang J, Han H, Zhao Y, Peng B, Zhong R, Ying W, Qian X: N-glycoproteome Analysis of the Secretome of Human Metastatic Hepatocellular Carcinoma Cell Lines Combining Hydrazide Chemistry, HILIC Enrichment and Mass Spectrometry. Plos One 2013, 8.
42Ma C, Zhao X, Han H, Tong W, Zhang Q, Qin P, Chang C, Peng B, Ying W, Qian X: N-linked glycoproteome profiling of human serum using tandem enrichment and multiple fraction concatenation. Electrophoresis 2013, 34:2440-2450.
44Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M: Glycoproteomic Analysis of the Secretome of Human Endothelial Cells. Molecular & Cellular Proteomics 2013, 12:956-978.
45Zhou H, Froehlich JW, Briscoe AC, Lee RS: The GlycoFilter: A Simple and Comprehensive Sample Preparation Platform for Proteomics, N-Glycomics and Glycosylation Site Assignment. Molecular & Cellular Proteomics 2013, 12:2981-2991.
47Almaraz RT, Tian Y, Bhattarcharya R, Tan E, Chen S-H, Dallas MR, Chen L, Zhang Z, Zhang H, Konstantopoulos K: Metabolic flux increases glycoprotein sialylation: implications for cell adhesion and cancer metastasis. Molecular & Cellular Proteomics 2012, 11:M112. 017558.
52Yen T-Y, Macher BA, McDonald CA, Alleyne-Chin C, Timpe LC: Glycoprotein Profiles of Human Breast Cells Demonstrate a Clear Clustering of Normal/Benign versus Malignant Cell Lines and Basal versus Luminal Cell Lines. Journal of Proteome Research 2012, 11:656-667.
54Tian Y, Yao Z, Roden R, Zhang H: Identification of glycoproteins associated with different histological subtypes of ovarian tumors using quantitative glycoproteomics. Proteomics 2011, 11:4677-4687.
63Cao J, Shen C, Wang H, Shen H, Chen Y, Nie A, Yan G, Lu H, Liu Y, Yang P: Identification of N-Glycosylation Sites on Secreted Proteins of Human Hepatocellular Carcinoma Cells with a Complementary Proteomics Approach. Journal of Proteome Research 2009, 8:662-672.
74Lewandrowski U, Zahedi RP, Moebius J, Walter U, Sickmann A: Enhanced N-glycosylation site analysis of Sialoglycopeptides by strong cation exchange prefractionation applied to platelet plasma membranes. Molecular & Cellular Proteomics 2007, 6:1933-1941.