Contains      

UniProtKB-P13987

Protein CD59 glycoprotein
Gene CD59
Status Reviewed
Source 22Rv1 cell line (prostate cancer); ARO Cell Line (Thyroid Cance); Bladder stromal cell line; Bladder tumor; Breast Cancer cell lines; Breast cancer cell lines; Breast cancer xenograftsPBMC Macrophage cells; Breast cell lines; Breast tumor; Cerebrospinal fluid; Colorectal cancer cell line, HCT-116 (colorectal cancer); Colorectal tumor; DLBCL cell lines (Diffuse large B-cell lymphoma); DRO-1 Cell Line (Thyroid Cance); FTC-133 Cell Line (Thyroid Cance); HCCLM3 cell line (Liver); HEK293 cell line (embryonic kidney); HeLa cell line (Cervical cancer); Hela cell line (cervical cancer); HuH-7 cell line (Liver); K562A cell line (Leukemia); K562S cell line (Leukemia); LNCap/PC3 cell lines (Prostate cancer); Liver; Liver tumor (HCC); Lung Adenocarcinoma; Lymphocytes; Non-small Cell Lung Carcinoma; OVCAR-3 cell line (Ovarian cancer); Ovarian cancer cell lines; Ovarian tumor; Pancreatic islets; Platelet; Platelet Plasma membranes; Prostate; Prostate cancer metastasis to liver; Prostate stromal cell line; Prostate tumor; SKOV-3 cell line (Ovarian cancer); SW1990 cell line (Pancreatic cancer); Serum; Spermatozoa; TPC-1 Cell Line (Thyroid Cance); Urine; UrineJurkat T cell line; XTC-1 Cell Line (Thyroid Cance); lung; milk; ovarian tumor; prostate cancer cell lines; umbilical vein Endothelial Cells
Years 2007-20072007

Glycosites

Site Identified Peptides Year(Publication ID)
43 TAVnCSSDFD 2014(33);
43 DCKTAVnCSSDFD 2013(37);
43 nCSSDFDACLITK 2015(1);
43 TAVnCSSDFDACLI 2014(14); 2015(unpublished);
43 VnCSSDFDACLITK 2014(14);
43 AVnCSSDFDACLITK 2012(48);
43 TAVnCSSDFDACIITK 2013(43); 2014(16); 2014(32); 2014(32);
43 TAVnCSSDFDACLITK 2007(72); 2007(74); 2007(70); 2008(62); 2009(62); 2009(62); 2009(62); 2009(62); 2009(63); 2009(65); 2009(65); 2009(67); 2009(54); 2011(58); 2011(3); 2012(50); 2012(51); 2012(52); 2012(34); 2013(34); 2013(34); 2013(38); 2013(39); 2013(42); 2013(44); 2013(45); 2013(13); 2014(14); 2014(36); 2014(15); 2014(17); 2014(18); 2014(22); 2014(25); 2014(25); 2014(33); 2014(1); 2015(2); 2015(3); 2015(5); 2015(10); 2015(12); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(UnpublishedUnpublished ); 2015;2007;2007;2007;2007;2007;2007;2007;2007;20072007 ;
43 NCPNPTADCKTAVnCSSDF 2014(33);
43 NCPNPTADCKTAVnCSSDFDAC 2014(33);
43 NCPNPTADCKTAVnCSSDFDACL 2014(33);

Sequence

1112131415161718191
MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQL
101111121
ENGGTSLSEKTVLLLVTPFLAAAWSLHP

Reference

ID Publication
1Sun S, Shah P, Eshghi ST, Yang W, Trikannad N, Yang S, Chen L, Aiyetan P, Hoti N, Zhang Z, et al: Comprehensive analysis of protein glycosylation by solid-phase extraction of N-linked glycans and glycosite-containing peptides. Nat Biotech 2015, advance online publication.
2Shah P, Wang X, Yang W, Eshghi ST, Sun S, Hoti N, Chen L, Yang S, Pasay J, Rubin A: Integrated Proteomic and Glycoproteomic Analyses of Prostate Cancer Cells Reveal Glycoprotein Alteration in Protein Abundance and Glycosylation. Molecular & Cellular Proteomics 2015, 14:2753-2763.
3Tian Y, Almaraz RT, Choi CH, Li QK, Saeui C, Li D, Shah P, Bhattacharya R, Yarema KJ, Zhang H: Identification of sialylated glycoproteins from metabolically oligosaccharide engineered pancreatic cells. Clinical proteomics 2015, 12:11.
5Goyallon A, Cholet S, Chapelle M, Junot C, Fenaille F: Evaluation of a combined glycomics and glycoproteomics approach for studying the major glycoproteins present in biofluids: Application to cerebrospinal fluid. Rapid Communications in Mass Spectrometry 2015, 29:461-473.
10Tan ZJ, Yin HD, Nie S, Lin ZX, Zhu JH, Ruffin MT, Anderson MA, Simone DM, Lubman DM: Large-Scale Identification of Core-Fucosylated Glycopeptide Sites in Pancreatic Cancer Serum Using Mass Spectrometry. Journal of Proteome Research 2015, 14:1968-1978.
12Weng Y, Sui Z, Jiang H, Shan Y, Chen L, Zhang S, Zhang L, Zhang Y: Releasing N-glycan from Peptide N-terminus by N-terminal Succinylation Assisted Enzymatic Deglycosylation. Scientific Reports 2015, 5.
13Yang W, Laeyendecker O, Wendel SK, Zhang B, Sun S, Zhou J-Y, Ao M, Moore RD, Jackson JB, Zhang H: Glycoproteomic Study Reveals Altered Plasma Proteins Associated with HIV Elite Suppressors. Theranostics 2014, 4:1153.
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
15Chen R, Seebun D, Ye M, Zou H, Figeys D: Site-specific characterization of cell membrane N-glycosylation with integrated hydrophilic interaction chromatography solid phase extraction and LC-MS/MS. Journal of Proteomics 2014, 103:194-203.
16Deeb SJ, Cox J, Schmidt-Supprian M, Mann M: N-linked Glycosylation Enrichment for In-depth Cell Surface Proteomics of Diffuse Large B-cell Lymphoma Subtypes. Molecular & Cellular Proteomics 2014, 13:240-251.
17Fang C, Xiong Z, Qin H, Huang G, Liu J, Ye M, Feng S, Zou H: One-pot synthesis of magnetic colloidal nanocrystal clusters coated with chitosan for selective enrichment of glycopeptides. Analytica Chimica Acta 2014, 841:99-105.
18Hirao Y, Matsuzaki H, Iwaki J, Kuno A, Kaji H, Ohkura T, Togayachi A, Abe M, Nomura M, Noguchi M, et al: Glycoproteomics Approach for Identifying Glycobiomarker Candidate Molecules for Tissue Type Classification of Non-small Cell Lung Carcinoma. Journal of Proteome Research 2014, 13:4705-4716.
22Nicastri A, Gaspari M, Sacco R, Elia L, Gabriele C, Romano R, Rizzuto A, Cuda G: N-Glycoprotein Analysis Discovers New Up-Regulated Glycoproteins in Colorectal Cancer Tissue. Journal of Proteome Research 2014, 13:4932-4941.
25Sun Z, Dong J, Zhang S, Hu Z, Cheng K, Li K, Xu B, Ye M, Nie Y, Fan D, Zou H: Identification of Chemoresistance-Related Cell-Surface Glycoproteins in Leukemia Cells and Functional Validation of Candidate Glycoproteins. Journal of Proteome Research 2014, 13:1593-1601.
32Zhang Z, Sun Z, Zhu J, Liu J, Huang G, Ye M, Zou H: High-Throughput Determination of the Site-Specific N-Sialoglycan Occupancy Rates by Differential Oxidation of Glycoproteins Followed with Quantitative Glycoproteomics Analysis. Analytical Chemistry 2014, 86:9830-9837.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
34Sun S, Zhang B, Aiyetan P, Zhou J-Y, Shah P, Yang W, Levine DA, Zhang Z, Chan DW, Zhang H: Analysis of N-glycoproteins using Genomic N-glycosite Prediction. Journal of Proteome Research 2013, 12:5609-5615.
36Li QK, Shah P, Li Y, Aiyetan PO, Chen J, Yung R, Molena D, Gabrielson E, Askin F, Chan DW: Glycoproteomic analysis of bronchoalveolar lavage (BAL) fluid identifies tumor-associated glycoproteins from lung adenocarcinoma. Journal of proteome research 2013, 12:3689-3696.
37Boersema PJ, Geiger T, Wisniewski JR, Mann M: Quantification of the N-glycosylated Secretome by Super-SILAC During Breast Cancer Progression and in Human Blood Samples. Molecular & Cellular Proteomics 2013, 12:158-171.
38Kaji H, Ocho M, Togayachi A, Kuno A, Sogabe M, Ohkura T, Nozaki H, Angata T, Chiba Y, Ozaki H, et al: Glycoproteomic Discovery of Serological Biomarker Candidates for HCV/HBV Infection-Associated Liver Fibrosis and Hepatocellular Carcinoma. Journal of Proteome Research 2013, 12:2630-2640.
39Li QK, Shah P, Li Y, Aiyetan PO, Chen J, Yung R, Molena D, Gabrielson E, Askin F, Chan DW, Zhang H: Glycoproteomic Analysis of Bronchoalveolar Lavage (BAL) Fluid Identifies Tumor-Associated Glycoproteins from Lung Adenocarcinonna. Journal of Proteome Research 2013, 12:3689-3696.
42Ma C, Zhao X, Han H, Tong W, Zhang Q, Qin P, Chang C, Peng B, Ying W, Qian X: N-linked glycoproteome profiling of human serum using tandem enrichment and multiple fraction concatenation. Electrophoresis 2013, 34:2440-2450.
43Wang GG, Wu YB, Zhou T, Guo YS, Zheng B, Wang J, Bi Y, Liu FJ, Zhou ZM, Guo XJ, Sha JH: Mapping of the N-Linked Glycoproteome of Human Spermatozoa. Journal of Proteome Research 2013, 12:5750-5759.
44Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M: Glycoproteomic Analysis of the Secretome of Human Endothelial Cells. Molecular & Cellular Proteomics 2013, 12:956-978.
45Zhou H, Froehlich JW, Briscoe AC, Lee RS: The GlycoFilter: A Simple and Comprehensive Sample Preparation Platform for Proteomics, N-Glycomics and Glycosylation Site Assignment. Molecular & Cellular Proteomics 2013, 12:2981-2991.
48Danzer C, Eckhardt K, Schmidt A, Fankhauser N, Ribrioux S, Wollscheid B, Mueller L, Schiess R, Zuellig R, Lehmann R, et al: Comprehensive Description of the N-Glycoproteome of Mouse Pancreatic beta-Cells and Human Islets. Journal of Proteome Research 2012, 11:1598-1608.
50Whitmore TE, Peterson A, Holzman T, Eastham A, Amon L, McIntosh M, Ozinsky A, Nelson PS, Martin DB: Integrative Analysis of N-Linked Human Glycoproteomic Data Sets Reveals PTPRF Ectodomain as a Novel Plasma Biomarker Candidate for Prostate Cancer. Journal of Proteome Research 2012, 11:2653-2665.
51Yeh C-H, Chen S-H, Li D-T, Lin H-P, Huang H-J, Chang C-I, Shih W-L, Chern C-L, Shi F-K, Hsu J-L: Magnetic bead-based hydrophilic interaction liquid chromatography for glycopeptide enrichments. Journal of Chromatography A 2012, 1224:70-78.
52Yen T-Y, Macher BA, McDonald CA, Alleyne-Chin C, Timpe LC: Glycoprotein Profiles of Human Breast Cells Demonstrate a Clear Clustering of Normal/Benign versus Malignant Cell Lines and Basal versus Luminal Cell Lines. Journal of Proteome Research 2012, 11:656-667.
54Tian Y, Yao Z, Roden R, Zhang H: Identification of glycoproteins associated with different histological subtypes of ovarian tumors using quantitative glycoproteomics. Proteomics 2011, 11:4677-4687.
58Nagano K, Shinkawa T, Kato K, Inomata N, Yabuki N, Haramura M: Distinct cell surface proteome profiling by biotin labeling and glycoprotein capturing. Journal of Proteomics 2011, 74:1985-1993.
62Arcinas A, Yen T-Y, Kebebew E, Macher BA: Cell Surface and Secreted Protein Profiles of Human Thyroid Cancer Cell Lines Reveal Distinct Glycoprotein Patterns. Journal of Proteome Research 2009, 8:3958-3968.
63Cao J, Shen C, Wang H, Shen H, Chen Y, Nie A, Yan G, Lu H, Liu Y, Yang P: Identification of N-Glycosylation Sites on Secreted Proteins of Human Hepatocellular Carcinoma Cells with a Complementary Proteomics Approach. Journal of Proteome Research 2009, 8:662-672.
65Goo YA, Lilu AY, Ryu S, Shaffer SA, Malmstrom L, Page L, Nguyen LT, Doneanu CE, Goodlett DR: Identification of Secreted Glycoproteins of Human Prostate and Bladder Stromal Cells by Comparative Quantitative Proteomics. Prostate 2009, 69:49-61.
67McDonald CA, Yang JY, Marathe V, Yen T-Y, Macher BA: Combining Results from Lectin Affinity Chromatography and Glycocapture Approaches Substantially Improves the Coverage of the Glycoproteome. Molecular & Cellular Proteomics 2009, 8:287-301.
70Picariello G, Ferranti P, Mamone G, Roepstorff P, Addeo F: Identification of N-linked glycoproteins in human milk by hydrophilic interaction liquid chromatography and mass spectrometry. Proteomics 2008, 8:3833-3847.
72Hanson SR, Hsu T-L, Weerapana E, Kishikawa K, Simon GM, Cravatt BF, Wong C-H: Tailored glycoproteomics and glycan site mapping using saccharide-selective bioorthogonal probes. Journal of the American Chemical Society 2007, 129:7266-+.
74Lewandrowski U, Zahedi RP, Moebius J, Walter U, Sickmann A: Enhanced N-glycosylation site analysis of Sialoglycopeptides by strong cation exchange prefractionation applied to platelet plasma membranes. Molecular & Cellular Proteomics 2007, 6:1933-1941.