Contains      

UniProtKB-P14415

Protein Sodium/potassium-transporting ATPase subunit beta-2
Gene ATP1B2
Status Reviewed
Source Breast cancer xenografts; HEK293 cell line (embryonic kidney); HEK293T cell line (embryonic kidney); HEK293T cell line (embryonic kidney), HEK293T cell line (embryonic kidney); K562A cell line (Leukemia); Liver; OVCAR-3 cell line (Ovarian cancer); Ovarian tumor; Pancreatic islets; Prostate; Prostate tumor; Urine
Years 2009-2015

Glycosites

Site Identified Peptides Year(Publication ID)
118 FLEPYnDSIQAQK 2011(57); 2012(48); 2014(14); 2014(15); 2014(25); 2014(33); 2015(unpublished);2015(1); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);
153 ACQFnR 2015(unpublished);
153 nRTQLGNCSGIGDSTHY 2014(33);
159 TQLGnCSGIGDSTHY 2014(33);
159 NRTQLGnCSGIGDSTHY 2014(33);
159 TQLGnCSGIGDSTHYGYSTGQPCVFIK 2014(15); 2015(9);
238 FHVnYTQPLVAVK 2009(64); 2011(57); 2012(48); 2014(15); 2014(33); 2015(unpublished);2015(1); 2015(unpublished);2015(unpublished);2015(unpublished);
250 nVTPNVEVNVECR 2015(1);
250 FLnVTPNVEVNVECR 2015(unpublished);

Sequence

1112131415161718191
MVIQKEKKSCGQVVEEWKEFVWNPRTHQFMGRTGTSWAFILLFYLVFYGFLTAMFTLTMWVMLQTVSDHTPKYQDRLATPGLMIRPKTENLDVIVNVSDT
101111121131141151161171181191
ESWDQHVQKLNKFLEPYNDSIQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGNCSGIGDSTHYGYSTGQPCVFIKMNRVINFYAGANQSMNVTC
201211221231241251261271281
AGKRDEDAENLGNFVMFPANGNIDLMYFPYYGKKFHVNYTQPLVAVKFLNVTPNVEVNVECRINAANIATDDERDKFAGRVAFKLRINKT

Reference

ID Publication
1Sun S, Shah P, Eshghi ST, Yang W, Trikannad N, Yang S, Chen L, Aiyetan P, Hoti N, Zhang Z, et al: Comprehensive analysis of protein glycosylation by solid-phase extraction of N-linked glycans and glycosite-containing peptides. Nat Biotech 2015, advance online publication.
9Smeekens JM, Chen WX, Wu RH: Mass Spectrometric Analysis of the Cell Surface N-Glycoproteome by Combining Metabolic Labeling and Click Chemistry. Journal of the American Society for Mass Spectrometry 2015, 26:604-614.
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
15Chen R, Seebun D, Ye M, Zou H, Figeys D: Site-specific characterization of cell membrane N-glycosylation with integrated hydrophilic interaction chromatography solid phase extraction and LC-MS/MS. Journal of Proteomics 2014, 103:194-203.
25Sun Z, Dong J, Zhang S, Hu Z, Cheng K, Li K, Xu B, Ye M, Nie Y, Fan D, Zou H: Identification of Chemoresistance-Related Cell-Surface Glycoproteins in Leukemia Cells and Functional Validation of Candidate Glycoproteins. Journal of Proteome Research 2014, 13:1593-1601.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
48Danzer C, Eckhardt K, Schmidt A, Fankhauser N, Ribrioux S, Wollscheid B, Mueller L, Schiess R, Zuellig R, Lehmann R, et al: Comprehensive Description of the N-Glycoproteome of Mouse Pancreatic beta-Cells and Human Islets. Journal of Proteome Research 2012, 11:1598-1608.
57Chen Y, Cao J, Yan G, Lu H, Yang P: Two-step protease digestion and glycopeptide capture approach for accurate glycosite identification and glycoprotein sequence coverage improvement. Talanta 2011, 85:70-75.
64Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res 2009, 8:651-661.