Contains      

UniProtKB-P15309

Protein Prostatic acid phosphatase
Gene ACPP
Status Reviewed
Source Colorectal tumor; DLBCL cell lines (Diffuse large B-cell lymphoma); LNCap/PC3 cell lines (Prostate cancer); Liver; OVCAR-3 cell line (Ovarian cancer); Ovarian tumor; Pancreatic islets; Prostate; Prostate tumor; Spermatozoa; Urine
Years 2007-2015

Glycosites

Site Identified Peptides Year(Publication ID)
94 FLnESYK 2007(55); 2011(48); 2012(51); 2012(14); 2014(22); 2014(1); 2015(2); 2015(unpublished);2015(unpublished);2015;2015;2015;2015;2007;2007;
94 KFLnESY 2014(14); 2015(unpublished);
94 KFLnESYK 2011(55); 2012(48); 2012(51); 2013(45); 2014(14); 2015(unpublished);2015(2); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);
94 FLnESYKHE 2014(14); 2015(unpublished);
94 FLnESYKHEQ 2014(14); 2015(unpublished);
94 FLnESYKHEQV 2014(14); 2015(unpublished);
94 FLnESYKHEQVY 2014(14); 2015(unpublished);
94 KFLnESYKHEQV 2014(14); 2015(unpublished);
94 nESYKHEQVYIR 2014(14);
94 FLnESYKHEQVYI 2014(14); 2015(unpublished);
94 KFLnESYKHEQVY 2014(14); 2015(unpublished);
94 LnESYKHEQVYIR 2014(14);
94 FLnESYKHEQVYIR 2012(48); 2013(45); 2014(14); 2015(unpublished);2015(1); 2015(2); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);
94 KFInESYKHEQVYIR 2013(43); 2014(16);
94 KFLnESYKHEQVYIR 2015(1); 2015(2); 2015(unpublished);2015(unpublished);2015(unpublished);
220 nFTLPSWATEDTMTK 2014(14);
220 DPLYCESVHnFTLPSWATEDTMTK 2014(14); 2015(unpublished);
220 VYDPIYCESVHnFTIPSWATEDTMTK 2013(43); 2014(16);
220 VYDPLYCESVHnFTLPSWATEDTMTK 2007(48); 2012(51); 2012(45); 2013(14); 2014(1); 2015(2); 2015(unpublished);2015(unpublished);2015;2015;2015;2007;2007;
333 nETQHEPYP 2014(14); 2015(unpublished);
333 YRnETQHEPYPL 2014(33);
333 nETQHEPYPLMLPG 2014(14); 2015(unpublished);
333 nETQHEPYPIMIPGCSPSCPIER 2013(43);
333 nETQHEPYPLMLPGCSPSCPLER 2007(45); 2013(14); 2014(unpublished);2015(unpublished);2015;2015;2015;2007;2007;
333 RnETQHEPYPLMLPGCSPSCPLER 2014(14); 2015(unpublished);
333 YRnETQHEPYPLMLPGCSPSCPLER 2014(14); 2015(unpublished);
333 YYRnETQHEPYPLMLPGCSPSCPLER 2014(14);
333 GEYFVEMYYRnETQHEPYPLMLPGCSPSCPLER 2013(45); 2015(unpublished);2015(unpublished);

Sequence

1112131415161718191
MRAAPLLLARAASLSLGFLFLLFFWLDRSVLAKELKFVTLVFRHGDRSPIDTFPTDPIKESSWPQGFGQLTQLGMEQHYELGEYIRKRYRKFLNESYKHE
101111121131141151161171181191
QVYIRSTDVDRTLMSAMTNLAALFPPEGVSIWNPILLWQPIPVHTVPLSEDQLLYLPFRNCPRFQELESETLKSEEFQKRLHPYKDFIATLGKLSGLHGQ
201211221231241251261271281291
DLFGIWSKVYDPLYCESVHNFTLPSWATEDTMTKLRELSELSLLSLYGIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMYSAHDTTVSGLQMAL
301311321331341351361371381
DVYNGLLPPYASCHLTELYFEKGEYFVEMYYRNETQHEPYPLMLPGCSPSCPLERFAELVGPVIPQDWSTECMTTNSHQGTEDSTD

Reference

ID Publication
1Sun S, Shah P, Eshghi ST, Yang W, Trikannad N, Yang S, Chen L, Aiyetan P, Hoti N, Zhang Z, et al: Comprehensive analysis of protein glycosylation by solid-phase extraction of N-linked glycans and glycosite-containing peptides. Nat Biotech 2015, advance online publication.
2Shah P, Wang X, Yang W, Eshghi ST, Sun S, Hoti N, Chen L, Yang S, Pasay J, Rubin A: Integrated Proteomic and Glycoproteomic Analyses of Prostate Cancer Cells Reveal Glycoprotein Alteration in Protein Abundance and Glycosylation. Molecular & Cellular Proteomics 2015, 14:2753-2763.
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
16Deeb SJ, Cox J, Schmidt-Supprian M, Mann M: N-linked Glycosylation Enrichment for In-depth Cell Surface Proteomics of Diffuse Large B-cell Lymphoma Subtypes. Molecular & Cellular Proteomics 2014, 13:240-251.
22Nicastri A, Gaspari M, Sacco R, Elia L, Gabriele C, Romano R, Rizzuto A, Cuda G: N-Glycoprotein Analysis Discovers New Up-Regulated Glycoproteins in Colorectal Cancer Tissue. Journal of Proteome Research 2014, 13:4932-4941.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
43Wang GG, Wu YB, Zhou T, Guo YS, Zheng B, Wang J, Bi Y, Liu FJ, Zhou ZM, Guo XJ, Sha JH: Mapping of the N-Linked Glycoproteome of Human Spermatozoa. Journal of Proteome Research 2013, 12:5750-5759.
45Zhou H, Froehlich JW, Briscoe AC, Lee RS: The GlycoFilter: A Simple and Comprehensive Sample Preparation Platform for Proteomics, N-Glycomics and Glycosylation Site Assignment. Molecular & Cellular Proteomics 2013, 12:2981-2991.
48Danzer C, Eckhardt K, Schmidt A, Fankhauser N, Ribrioux S, Wollscheid B, Mueller L, Schiess R, Zuellig R, Lehmann R, et al: Comprehensive Description of the N-Glycoproteome of Mouse Pancreatic beta-Cells and Human Islets. Journal of Proteome Research 2012, 11:1598-1608.
51Yeh C-H, Chen S-H, Li D-T, Lin H-P, Huang H-J, Chang C-I, Shih W-L, Chern C-L, Shi F-K, Hsu J-L: Magnetic bead-based hydrophilic interaction liquid chromatography for glycopeptide enrichments. Journal of Chromatography A 2012, 1224:70-78.
55Tian Y, Bova GS, Zhang H: Quantitative glycoproteomic analysis of optimal cutting temperature-embedded frozen tissues identifying glycoproteins associated with aggressive prostate cancer. Analytical chemistry 2011, 83:7013-7019.