Contains      

UniProtKB-P16422

Protein Epithelial cell adhesion molecule
Gene EPCAM
Status Reviewed
Source 22Rv1 cell line (prostate cancer); Breast Cancer cell lines; Breast cancer xenografts; Breast cell lines; Breast tumor; Colorectal cancer cell line, HCT-116 (colorectal cancer); IGROV-1/CP cell line (Ovarian cancer)IGROV-1/CP; LNCap/PC3 cell lines (Prostate cancer); Liver; OVCAR-3 cell line (Ovarian cancer); Ovarian tumor; Pancreatic islets; Prostate; Prostate tumor; prostate cancer cell lines
Years 2007-2015

Glycosites

Site Identified Peptides Year(Publication ID)
74 AEMnGSK 2012(50); 2015(unpublished);2015(unpublished);
74 AEMnGSKLGR 2011(58);
74 CLVMKAEMnGSK 2011(58);
74 CLVMKAEMnGSKLGR 2011(58);
111 FKAKQCnGTSMCW 2013(37);
111 nGTSMCWCVNTAGVR 2015(1);
111 QCnGTSMCWCVNTAGVR 2012(52); 2015(unpublished);2015(1); 2015(unpublished);
111 AKQCnGTSMCWCVNTAGVR 2012(52);
198 LVQnSSQK 2014(14); 2015(unpublished);
198 DLVQnSSQK 2012(48); 2014(14); 2015(unpublished);2007(unpublished);2007(unpublished);2007;
198 IDLVQnSSQK 2014(14); 2015(unpublished);
198 LVQnSSQKTQND 2009(64);
198 VITIDLVQnSSQK 2014(14); 2015(unpublished);2015(unpublished);
198 NVITIDLVQnSSQK 2014(14); 2015(unpublished);2015(unpublished);
198 NNVITIDLVQnSSQK 2014(33);
198 ENNVITIDLVQnSSQK 2012(48); 2015(unpublished);
198 LYENNVITIDLVQnSSQK 2015(unpublished);
198 ITSILYENNVITIDLVQnSSQK 2015(unpublished);
198 FITSILYENNVITIDLVQnSSQK 2007(72); 2007(75); 2012(52); 2015(unpublished);2015(1); 2015(2);

Sequence

1112131415161718191
MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCD
101111121131141151161171181191
ESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSS
201211221231241251261271281291
QKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKA
301311
EIKEMGEMHRELNA

Reference

ID Publication
1Sun S, Shah P, Eshghi ST, Yang W, Trikannad N, Yang S, Chen L, Aiyetan P, Hoti N, Zhang Z, et al: Comprehensive analysis of protein glycosylation by solid-phase extraction of N-linked glycans and glycosite-containing peptides. Nat Biotech 2015, advance online publication.
2Shah P, Wang X, Yang W, Eshghi ST, Sun S, Hoti N, Chen L, Yang S, Pasay J, Rubin A: Integrated Proteomic and Glycoproteomic Analyses of Prostate Cancer Cells Reveal Glycoprotein Alteration in Protein Abundance and Glycosylation. Molecular & Cellular Proteomics 2015, 14:2753-2763.
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
37Boersema PJ, Geiger T, Wisniewski JR, Mann M: Quantification of the N-glycosylated Secretome by Super-SILAC During Breast Cancer Progression and in Human Blood Samples. Molecular & Cellular Proteomics 2013, 12:158-171.
48Danzer C, Eckhardt K, Schmidt A, Fankhauser N, Ribrioux S, Wollscheid B, Mueller L, Schiess R, Zuellig R, Lehmann R, et al: Comprehensive Description of the N-Glycoproteome of Mouse Pancreatic beta-Cells and Human Islets. Journal of Proteome Research 2012, 11:1598-1608.
50Whitmore TE, Peterson A, Holzman T, Eastham A, Amon L, McIntosh M, Ozinsky A, Nelson PS, Martin DB: Integrative Analysis of N-Linked Human Glycoproteomic Data Sets Reveals PTPRF Ectodomain as a Novel Plasma Biomarker Candidate for Prostate Cancer. Journal of Proteome Research 2012, 11:2653-2665.
52Yen T-Y, Macher BA, McDonald CA, Alleyne-Chin C, Timpe LC: Glycoprotein Profiles of Human Breast Cells Demonstrate a Clear Clustering of Normal/Benign versus Malignant Cell Lines and Basal versus Luminal Cell Lines. Journal of Proteome Research 2012, 11:656-667.
58Nagano K, Shinkawa T, Kato K, Inomata N, Yabuki N, Haramura M: Distinct cell surface proteome profiling by biotin labeling and glycoprotein capturing. Journal of Proteomics 2011, 74:1985-1993.
64Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res 2009, 8:651-661.
72Hanson SR, Hsu T-L, Weerapana E, Kishikawa K, Simon GM, Cravatt BF, Wong C-H: Tailored glycoproteomics and glycan site mapping using saccharide-selective bioorthogonal probes. Journal of the American Chemical Society 2007, 129:7266-+.
75Sun B, Ranish JA, Utleg AG, White JT, Yan X, Lin B, Hood L: Shotgun glycopeptide capture approach coupled with mass Spectrometry for comprehensive glycoproteomics. Molecular & Cellular Proteomics 2007, 6:141-149.