Contains      

UniProtKB-P16444

Protein Dipeptidase 1
Gene DPEP1
Status Reviewed
Source Colorectal tumor; DLBCL cell lines (Diffuse large B-cell lymphoma); HepG2 cell line (Liver); Jurkat T cell line; Liver; Non-small Cell Lung Carcinoma; Ovarian tumor; Pancreatic islets; Prostate; Prostate tumor; Spermatozoa; Urine; UrineJurkat T cell line
Years 2007-2015

Glycosites

Site Identified Peptides Year(Publication ID)
57 nLTTLAGTHTNIPK 2012(48);
57 AnITTIAGTHTNIPK 2014(16);
57 AnLTTLAGTHTNIPK 2007(64); 2009(48); 2012(51); 2012(45); 2013(13); 2014(14); 2014(22); 2014(33); 2014(unpublished);2015(unpublished);2015;2015;2007;2007;
57 IQDERAnITTIAGTHTNIPK 2013(43);
57 LQDERAnLTTLAGTHTNIPK 2014(13); 2015(unpublished);2015(unpublished);
279 nLSQVADHLDHIK 2012(48);
279 AnISQVADHIDHIK 2014(16);
279 AnLSQVADHLDHIK 2007(64); 2009(48); 2012(45); 2013(13); 2014(14); 2014(22); 2014(33); 2014(unpublished);2015(unpublished);2015;2015;2015;2007;2007;
279 AnLSQVADHLDHIKE 2014(33);
279 AnISQVADHIDHIKEVAGAR 2013(43);
279 AnLSQVADHLDHIKEVAGAR 2013(45); 2015(unpublished);2015(unpublished);
332 nWTEAEVK 2013(45); 2014(22);
332 RnWTEAEVK 2007(48); 2012(45); 2013(13); 2014(16); 2014(22); 2014(33); 2014(unpublished);2015(unpublished);2015;2015;2007;2007;
332 YPDLIAELLRRnWTEAEVK 2013(38);
358 VFEAVEQASnITQAPEEEPIPIDQIGGSCR 2013(43);
358 VFEAVEQASnLTQAPEEEPIPLDQLGGSCR 2007(48); 2012(45); 2013(14); 2014(18); 2014(unpublished);2015(unpublished);2015;2015;2007;2007;

Sequence

1112131415161718191
MWSGWWLWPLVAVCTADFFRDEAERIMRDSPVIDGHNDLPWQLLDMFNNRLQDERANLTTLAGTHTNIPKLRAGFVGGQFWSVYTPCDTQNKDAVRRTLE
101111121131141151161171181191
QMDVVHRMCRMYPETFLYVTSSAGIRQAFREGKVASLIGVEGGHSIDSSLGVLRALYQLGMRYLTLTHSCNTPWADNWLVDTGDSEPQSQGLSPFGQRVV
201211221231241251261271281291
KELNRLGVLIDLAHVSVATMKATLQLSRAPVIFSHSSAYSVCASRRNVPDDVLRLVKQTDSLVMVNFYNNYISCTNKANLSQVADHLDHIKEVAGARAVG
301311321331341351361371381391
FGGDFDGVPRVPEGLEDVSKYPDLIAELLRRNWTEAEVKGALADNLLRVFEAVEQASNLTQAPEEEPIPLDQLGGSCRTHYGYSSGASSLHRHWGLLLAS
401411
LAPLVLCLSLL

Reference

ID Publication
13Yang W, Laeyendecker O, Wendel SK, Zhang B, Sun S, Zhou J-Y, Ao M, Moore RD, Jackson JB, Zhang H: Glycoproteomic Study Reveals Altered Plasma Proteins Associated with HIV Elite Suppressors. Theranostics 2014, 4:1153.
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
16Deeb SJ, Cox J, Schmidt-Supprian M, Mann M: N-linked Glycosylation Enrichment for In-depth Cell Surface Proteomics of Diffuse Large B-cell Lymphoma Subtypes. Molecular & Cellular Proteomics 2014, 13:240-251.
18Hirao Y, Matsuzaki H, Iwaki J, Kuno A, Kaji H, Ohkura T, Togayachi A, Abe M, Nomura M, Noguchi M, et al: Glycoproteomics Approach for Identifying Glycobiomarker Candidate Molecules for Tissue Type Classification of Non-small Cell Lung Carcinoma. Journal of Proteome Research 2014, 13:4705-4716.
22Nicastri A, Gaspari M, Sacco R, Elia L, Gabriele C, Romano R, Rizzuto A, Cuda G: N-Glycoprotein Analysis Discovers New Up-Regulated Glycoproteins in Colorectal Cancer Tissue. Journal of Proteome Research 2014, 13:4932-4941.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
38Kaji H, Ocho M, Togayachi A, Kuno A, Sogabe M, Ohkura T, Nozaki H, Angata T, Chiba Y, Ozaki H, et al: Glycoproteomic Discovery of Serological Biomarker Candidates for HCV/HBV Infection-Associated Liver Fibrosis and Hepatocellular Carcinoma. Journal of Proteome Research 2013, 12:2630-2640.
43Wang GG, Wu YB, Zhou T, Guo YS, Zheng B, Wang J, Bi Y, Liu FJ, Zhou ZM, Guo XJ, Sha JH: Mapping of the N-Linked Glycoproteome of Human Spermatozoa. Journal of Proteome Research 2013, 12:5750-5759.
45Zhou H, Froehlich JW, Briscoe AC, Lee RS: The GlycoFilter: A Simple and Comprehensive Sample Preparation Platform for Proteomics, N-Glycomics and Glycosylation Site Assignment. Molecular & Cellular Proteomics 2013, 12:2981-2991.
48Danzer C, Eckhardt K, Schmidt A, Fankhauser N, Ribrioux S, Wollscheid B, Mueller L, Schiess R, Zuellig R, Lehmann R, et al: Comprehensive Description of the N-Glycoproteome of Mouse Pancreatic beta-Cells and Human Islets. Journal of Proteome Research 2012, 11:1598-1608.
51Yeh C-H, Chen S-H, Li D-T, Lin H-P, Huang H-J, Chang C-I, Shih W-L, Chern C-L, Shi F-K, Hsu J-L: Magnetic bead-based hydrophilic interaction liquid chromatography for glycopeptide enrichments. Journal of Chromatography A 2012, 1224:70-78.
64Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res 2009, 8:651-661.