Contains      

UniProtKB-P19256

Protein Lymphocyte function-associated antigen 3
Gene CD58
Status Reviewed
Source Breast Cancer cell lines; Breast cancer xenografts; Breast cell lines; Breast tumor; Colorectal tumor; DLBCL cell lines (Diffuse large B-cell lymphoma); HCC cell lines (Liver); Hela cell line (cervical cancer); HepG2 cell line (Liver); Jurkat T cell line; LNCap/PC3 cell lines (Prostate cancer); Liver; Lymphocytes; OVCAR-3 cell line (Ovarian cancer); Ovarian tumor; Platelet; Platelet Plasma membranes; Prostate; Prostate tumor; Urine; UrineJurkat T cell line
Years 2007-2015

Glycosites

Site Identified Peptides Year(Publication ID)
40 nVTFHVPSNVPLK 2015(1);
40 GnVTFHVPSNVPLK 2015(unpublished);
40 GVVYGnVTFHVPSNVPL 2014(33);
40 VVYGnVTFHVPSNVPLK 2007(unpublished);2007(unpublished);2007;
40 FSQQIYGVVYGnVTFHVPSNVPLK 2015(unpublished);
94 VYLDTVSGSLTIYnLTSSDEDEYEMESPNITDTMK 2015(2); 2015(unpublished);2007(unpublished);2007(unpublished);2007;
109 MESPnITDTMK 2014(33);
109 VYLDTVSGSLTIYNLTSSDEDEYEMESPnITDTMK 2015(2); 2015(unpublished);2007(unpublished);2007(unpublished);2007;
135 SLPSPTLTCALTnGSIE 2014(33);
135 nGSIEVQCMIPEHYNSHR 2015(1);
169 nSTSIYFK 2007(74); 2007(40); 2013(45); 2013(13); 2014(14); 2014(22); 2014(33); 2014(2); 2015(12); 2015(unpublished);2015(unpublished);2015;2015;2015;2015;2015;2007;2007;
169 RnSTSIYFK 2013(38); 2014(13); 2014(16); 2015(unpublished);2015(2); 2015(unpublished);
169 MEQCKRnSTSIYF 2013(37);
195 nTTSSIILTTCIPSSGHSR 2015(1);
195 IQCTISNPIFnTTSSIIITTCIPSSGHSR 2014(16);
195 IQCTLSNPLFnTTSSIILTTCIPSSGHSR 2012(52); 2015(unpublished);2015(1); 2015(12);

Sequence

1112131415161718191
MVAGSDAGRALGVLSVVCLLHCFGFISCFSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDE
101111121131141151161171181191
DEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEHYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSI
201211221231241
ILTTCIPSSGHSRHRYALIPIPLAVITTCIVLYMNGILKCDRKPDRTNSN

Reference

ID Publication
1Sun S, Shah P, Eshghi ST, Yang W, Trikannad N, Yang S, Chen L, Aiyetan P, Hoti N, Zhang Z, et al: Comprehensive analysis of protein glycosylation by solid-phase extraction of N-linked glycans and glycosite-containing peptides. Nat Biotech 2015, advance online publication.
2Shah P, Wang X, Yang W, Eshghi ST, Sun S, Hoti N, Chen L, Yang S, Pasay J, Rubin A: Integrated Proteomic and Glycoproteomic Analyses of Prostate Cancer Cells Reveal Glycoprotein Alteration in Protein Abundance and Glycosylation. Molecular & Cellular Proteomics 2015, 14:2753-2763.
12Weng Y, Sui Z, Jiang H, Shan Y, Chen L, Zhang S, Zhang L, Zhang Y: Releasing N-glycan from Peptide N-terminus by N-terminal Succinylation Assisted Enzymatic Deglycosylation. Scientific Reports 2015, 5.
13Yang W, Laeyendecker O, Wendel SK, Zhang B, Sun S, Zhou J-Y, Ao M, Moore RD, Jackson JB, Zhang H: Glycoproteomic Study Reveals Altered Plasma Proteins Associated with HIV Elite Suppressors. Theranostics 2014, 4:1153.
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
16Deeb SJ, Cox J, Schmidt-Supprian M, Mann M: N-linked Glycosylation Enrichment for In-depth Cell Surface Proteomics of Diffuse Large B-cell Lymphoma Subtypes. Molecular & Cellular Proteomics 2014, 13:240-251.
22Nicastri A, Gaspari M, Sacco R, Elia L, Gabriele C, Romano R, Rizzuto A, Cuda G: N-Glycoprotein Analysis Discovers New Up-Regulated Glycoproteins in Colorectal Cancer Tissue. Journal of Proteome Research 2014, 13:4932-4941.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
37Boersema PJ, Geiger T, Wisniewski JR, Mann M: Quantification of the N-glycosylated Secretome by Super-SILAC During Breast Cancer Progression and in Human Blood Samples. Molecular & Cellular Proteomics 2013, 12:158-171.
38Kaji H, Ocho M, Togayachi A, Kuno A, Sogabe M, Ohkura T, Nozaki H, Angata T, Chiba Y, Ozaki H, et al: Glycoproteomic Discovery of Serological Biomarker Candidates for HCV/HBV Infection-Associated Liver Fibrosis and Hepatocellular Carcinoma. Journal of Proteome Research 2013, 12:2630-2640.
40Li X, Jiang J, Zhao X, Wang J, Han H, Zhao Y, Peng B, Zhong R, Ying W, Qian X: N-glycoproteome Analysis of the Secretome of Human Metastatic Hepatocellular Carcinoma Cell Lines Combining Hydrazide Chemistry, HILIC Enrichment and Mass Spectrometry. Plos One 2013, 8.
45Zhou H, Froehlich JW, Briscoe AC, Lee RS: The GlycoFilter: A Simple and Comprehensive Sample Preparation Platform for Proteomics, N-Glycomics and Glycosylation Site Assignment. Molecular & Cellular Proteomics 2013, 12:2981-2991.
52Yen T-Y, Macher BA, McDonald CA, Alleyne-Chin C, Timpe LC: Glycoprotein Profiles of Human Breast Cells Demonstrate a Clear Clustering of Normal/Benign versus Malignant Cell Lines and Basal versus Luminal Cell Lines. Journal of Proteome Research 2012, 11:656-667.
74Lewandrowski U, Zahedi RP, Moebius J, Walter U, Sickmann A: Enhanced N-glycosylation site analysis of Sialoglycopeptides by strong cation exchange prefractionation applied to platelet plasma membranes. Molecular & Cellular Proteomics 2007, 6:1933-1941.