Contains      

UniProtKB-P19652

Protein Alpha-1-acid glycoprotein 2
Gene ORM2
Status Reviewed
Source Bladder tumor; Breast tumor; Cerebrospinal fluid; HEK293 cell line (embryonic kidney); HepG2 cell line (Liver); HuH-7 cell line (Liver); Liver; Liver tumor (HCC); Lung tumor; Ovarian tumor; Plasma; Platelet; Prostate; Prostate cancer metastasis to liver; Prostate tumor; Serum; Serum (Colorectal cancer); Serum (HCC); Urine; ovarian tumor; plasma
Years 2004-20072007

Glycosites

Site Identified Peptides Year(Publication ID)
33 TnATLDR 2007(unpublished);2007(unpublished);2007;
33 ITnATLDR 2007(14); 2014(unpublished);2015(unpublished);2007;2007;
33 PITnATLDR 2011(54); 2012(3); 2014(14); 2015(unpublished);
33 VPITnATLDR 2014(14); 2015(unpublished);
33 VPVPITnATL 2014(33);
33 LVPVPITnATL 2014(33);
33 PVPITnATLDR 2014(14); 2014(21); 2014(33); 2015(unpublished);
33 LVPVPITnATLD 2014(33);
33 NLVPVPITnATL 2009(64); 2014(33);
33 VPVPITnATLDR 2014(14); 2014(33); 2015(unpublished);
33 ANLVPVPITnATL 2014(33);
33 CANLVPVPITnAT 2014(33);
33 LVPVPITnATLDR 2004(82); 2010(60); 2014(14); 2014(28); 2014(33); 2015(unpublished);2015(unpublished);
33 CANLVPVPITnATL 2014(33);
33 NLVPVPITnATLDR 2014(14); 2015(unpublished);
33 ANLVPVPITnATLDR 2014(14); 2015(unpublished);
33 CANLVPVPITnATLD 2014(33);
33 CANLVPVPITnATLDR 2005(79); 2005(80); 2012(49); 2014(14); 2014(33); 2015(unpublished);
33 LCANLVPVPITnATLDR 2014(14); 2015(unpublished);
33 LVPVPITnATLDRITGK 2015(unpublished);
33 PLCANLVPVPITnATLDR 2014(14);
33 ANLVPVPITnATLDRITGKW 2014(33);
33 QIPLCANLVPVPITnATLDR 2004(82); 2014(14); 2014(33); 2015(5);
33 CANLVPVPITnATLDRITGKW 2014(33);
33 CANLVPVPITnATLDRITGKWF 2014(33);
33 CANLVPVPITnATLDRITGKWFY 2014(33);
33 LEAQIPLCANLVPVPITnATLDR 2005(81);
33 QIPLCANLVPVPITnATLDRITGK 2014(33);
56 NEEYnK 2005( 81); 2007(73); 2012(53); 2014(26); 2014(31); 2014(33); 2015(unpublished);2015(unpublished);2015(unpublished);2007(unpublished);2007(unpublished);2007(UnpublishedUnpublished ); 2007;2007;20072007 ;
56 YnKSVQE 2013(42); 2014(33);
56 NEEYnKSV 2014(14); 2015(unpublished);
56 NEEYnKSVQ 2014(14); 2015(unpublished);
56 AFRNEEYnKS 2009(64);
56 NEEYnKSVQE 2014(14); 2014(33); 2015(unpublished);
56 RNEEYnKSVQ 2014(33);
56 NEEYnKSVQEI 2014(14); 2015(unpublished);
56 nKSVQEIQATF 2014(33);
56 FRNEEYnKSVQE 2009(64);
56 NEEYnKSVQEIQ 2014(14); 2015(unpublished);
56 nKSVQEIQATFF 2014(33);
56 NEEYnKSVQEIQA 2014(14); 2015(unpublished);
56 RNEEYnKSVQEIQ 2014(33);
56 EEYnKSVQEIQATF 2014(33);
56 NEEYnKSVQEIQAT 2014(14); 2015(unpublished);
56 RNEEYnKSVQEIQA 2014(33);
56 NEEYnKSVQEIQATF 2014(33);
56 RNEEYnKSVQEIQAT 2014(33);
56 WFYIASAFRNEEYnK 2012(53); 2013(38); 2013(38); 2013(38); 2013(42); 2014(35); 2015(unpublished);2015(unpublished);2015(unpublished);
56 NEEYnKSVQEIQATFF 2014(33);
56 RNEEYnKSVQEIQATF 2014(33);
56 RNEEYnKSVQEIQATFF 2014(33);
56 NEEYnKSVQEIQATFFYFTPNK 2010(59); 2013(45); 2015(unpublished);
56 NEEYnKSVQEIQATFFYFTPNKTEDTIFLR 2010(59); 2012(53); 2013(42); 2014(13); 2014(35); 2014(31); 2014(33); 2015(unpublished);2015(unpublished);2015(unpublished);
72 YFTPnK 2014(33);
72 FYFTPnK 2014(33);
72 nKTEDTIF 2014(33);
72 YFTPnKTE 2014(33);
72 FYFTPnKTE 2014(33);
72 YFTPnKTED 2014(33);
72 FFYFTPnKTE 2014(33);
72 FYFTPnKTED 2014(33);
72 TPnKTEDTIF 2014(33);
72 FTPnKTEDTIF 2014(33);
72 YFTPnKTEDTI 2014(33);
72 FTPnKTEDTIFL 2014(33);
72 FYFTPnKTEDTI 2014(33);
72 IQATFFYFTPnK 2014(33);
72 TPnKTEDTIFLR 2014(14); 2014(21); 2014(33); 2015(unpublished);
72 YFTPnKTEDTIF 2014(33);
72 FTPnKTEDTIFLR 2014(33); 2015(unpublished);
72 FYFTPnKTEDTIF 2014(33);
72 YFTPnKTEDTIFL 2014(33);
72 FYFTPnKTEDTIFL 2014(33);
72 IQATFFYFTPnKTE 2013(42); 2014(33);
72 TPnKTEDTIFLREY 2014(33);
72 YFTPnKTEDTIFLR 2014(14); 2014(21); 2014(28); 2014(33); 2015(unpublished);
72 FTPnKTEDTIFLREY 2014(33);
72 FYFTPnKTEDTIFLR 2010(60); 2014(14); 2014(21); 2014(33); 2015(unpublished);
72 IQATFFYFTPnKTED 2013(42); 2014(33);
72 YFTPnKTEDTIFLRE 2014(33);
72 FFYFTPnKTEDTIFLR 2004(82); 2014(14); 2014(33); 2015(unpublished);2015(unpublished);
72 FYFTPnKTEDTIFLRE 2014(33);
72 SVQEIQATFFYFTPnK 2004( 82); 2005(81); 2007(38); 2013(38); 2013(42); 2013(45); 2013(13); 2014(24); 2014(26); 2014(33); 2014(5); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2007(UnpublishedUnpublished ); 2007;2007;2007;2007;2007;20072007 ;
72 YFTPnKTEDTIFLREY 2014(33);
72 FYFTPnKTEDTIFLREY 2014(33);
72 SVQEIQATFFYFTPnKT 2013(38); 2015(unpublished);
72 TFFYFTPnKTEDTIFLR 2014(33); 2015(unpublished);
72 ATFFYFTPnKTEDTIFLR 2015(unpublished);
72 IQATFFYFTPnKTEDTIF 2014(33);
72 IQATFFYFTPnKTEDTIFLR 2014(33);
72 IQATFFYFTPnKTEDTIFLRE 2013(42); 2014(33);
72 NEEYNKSVQEIQATFFYFTPnK 2010(59); 2013(45); 2015(unpublished);
72 SVQEIQATFFYFTPnKTEDTIFLR 2004(82); 2005(79); 2005(80); 2006(76); 2008(69); 2010(59); 2010(40); 2012(51); 2012(53); 2013(34); 2013(38); 2013(38); 2013(42); 2013(45); 2014(13); 2014(14); 2014(35); 2014(15); 2014(26); 2014(33); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);
72 NEEYNKSVQEIQATFFYFTPnKTEDTIFLR 2010(59); 2012(53); 2013(42); 2014(13); 2014(35); 2014(31); 2014(33); 2015(unpublished);2015(unpublished);2015(unpublished);
93 CFYnSSYL 2014(33);
93 nSSYLNVQR 2014(33); 2015(unpublished);
93 YnSSYLNVQR 2015(unpublished);
93 FYnSSYLNVQR 2014(33); 2015(unpublished);
93 QNQCFYnSSYL 2014(33);
93 QNQCFYnSSYINVQR 2014(32); 2014(32);

Sequence

1112131415161718191
MALSWVLTVLSLLPLLEAQIPLCANLVPVPITNATLDRITGKWFYIASAFRNEEYNKSVQEIQATFFYFTPNKTEDTIFLREYQTRQNQCFYNSSYLNVQ
101111121131141151161171181191
RENGTVSRYEGGREHVAHLLFLRDTKTLMFGSYLDDEKNWGLSFYADKPETTKEQLGEFYEALDCLCIPRSDVMYTDWKKDKCEPLEKQHEKERKQEEGE
201
S

Reference

ID Publication
3Tian Y, Almaraz RT, Choi CH, Li QK, Saeui C, Li D, Shah P, Bhattacharya R, Yarema KJ, Zhang H: Identification of sialylated glycoproteins from metabolically oligosaccharide engineered pancreatic cells. Clinical proteomics 2015, 12:11.
5Goyallon A, Cholet S, Chapelle M, Junot C, Fenaille F: Evaluation of a combined glycomics and glycoproteomics approach for studying the major glycoproteins present in biofluids: Application to cerebrospinal fluid. Rapid Communications in Mass Spectrometry 2015, 29:461-473.
13Yang W, Laeyendecker O, Wendel SK, Zhang B, Sun S, Zhou J-Y, Ao M, Moore RD, Jackson JB, Zhang H: Glycoproteomic Study Reveals Altered Plasma Proteins Associated with HIV Elite Suppressors. Theranostics 2014, 4:1153.
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
15Chen R, Seebun D, Ye M, Zou H, Figeys D: Site-specific characterization of cell membrane N-glycosylation with integrated hydrophilic interaction chromatography solid phase extraction and LC-MS/MS. Journal of Proteomics 2014, 103:194-203.
21Liu L, Yu M, Zhang Y, Wang C, Lu H: Hydrazide Functionalized Core-Shell Magnetic Nanocomposites for Highly Specific Enrichment of N-Glycopeptides. Acs Applied Materials & Interfaces 2014, 6:7823-7832.
24Song E, Zhu R, Hammond ZT, Mechref Y: LC-MS/MS Quantitation of Esophagus Disease Blood Serum Glycoproteins by Enrichment with Hydrazide Chemistry and Lectin Affinity Chromatography. Journal of Proteome Research 2014, 13:4808-4820.
26Takakura D, Harazono A, Hashii N, Kawasaki N: Selective glycopeptide profiling by acetone enrichment and LC/MS. Journal of Proteomics 2014, 101:17-30.
28Wang Y, Liu M, Xie L, Fang C, Xiong H, Lu H: Highly Efficient Enrichment Method for Glycopeptide Analyses: Using Specific and Nonspecific Nanoparticles Synergistically. Analytical Chemistry 2014, 86:2057-2064.
31Zhang L, Jiang H, Yao J, Wang Y, Fang C, Yang P, Lu H: Highly specific enrichment of N-linked glycopeptides based on hydrazide functionalized soluble nanopolymers. Chemical Communications 2014, 50:1027-1029.
32Zhang Z, Sun Z, Zhu J, Liu J, Huang G, Ye M, Zou H: High-Throughput Determination of the Site-Specific N-Sialoglycan Occupancy Rates by Differential Oxidation of Glycoproteins Followed with Quantitative Glycoproteomics Analysis. Analytical Chemistry 2014, 86:9830-9837.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
34Sun S, Zhang B, Aiyetan P, Zhou J-Y, Shah P, Yang W, Levine DA, Zhang Z, Chan DW, Zhang H: Analysis of N-glycoproteins using Genomic N-glycosite Prediction. Journal of Proteome Research 2013, 12:5609-5615.
35Chen J, Shah P, Zhang H: Solid phase extraction of N-linked glycopeptides using hydrazide tip. Analytical chemistry 2013, 85:10670-10674.
38Kaji H, Ocho M, Togayachi A, Kuno A, Sogabe M, Ohkura T, Nozaki H, Angata T, Chiba Y, Ozaki H, et al: Glycoproteomic Discovery of Serological Biomarker Candidates for HCV/HBV Infection-Associated Liver Fibrosis and Hepatocellular Carcinoma. Journal of Proteome Research 2013, 12:2630-2640.
40Li X, Jiang J, Zhao X, Wang J, Han H, Zhao Y, Peng B, Zhong R, Ying W, Qian X: N-glycoproteome Analysis of the Secretome of Human Metastatic Hepatocellular Carcinoma Cell Lines Combining Hydrazide Chemistry, HILIC Enrichment and Mass Spectrometry. Plos One 2013, 8.
42Ma C, Zhao X, Han H, Tong W, Zhang Q, Qin P, Chang C, Peng B, Ying W, Qian X: N-linked glycoproteome profiling of human serum using tandem enrichment and multiple fraction concatenation. Electrophoresis 2013, 34:2440-2450.
45Zhou H, Froehlich JW, Briscoe AC, Lee RS: The GlycoFilter: A Simple and Comprehensive Sample Preparation Platform for Proteomics, N-Glycomics and Glycosylation Site Assignment. Molecular & Cellular Proteomics 2013, 12:2981-2991.
49Kim JY, Kim S-K, Kang D, Moon MH: Dual Lectin-Based Size Sorting Strategy to Enrich Targeted N-Glycopeptides by Asymmetrical Flow Field-Flow Fractionation: Profiling Lung Cancer Biomarkers. Analytical Chemistry 2012, 84:5343-5350.
51Yeh C-H, Chen S-H, Li D-T, Lin H-P, Huang H-J, Chang C-I, Shih W-L, Chern C-L, Shi F-K, Hsu J-L: Magnetic bead-based hydrophilic interaction liquid chromatography for glycopeptide enrichments. Journal of Chromatography A 2012, 1224:70-78.
53Zhu J, Wang F, Chen R, Cheng K, Xu B, Guo Z, Liang X, Ye M, Zou H: Centrifugation Assisted Microreactor Enables Facile Integration of Trypsin Digestion, Hydrophilic Interaction Chromatography Enrichment, and On-Column Deglycosylation for Rapid and Sensitive N-Glycoproteome Analysis. Analytical Chemistry 2012, 84:5146-5153.
54Tian Y, Yao Z, Roden R, Zhang H: Identification of glycoproteins associated with different histological subtypes of ovarian tumors using quantitative glycoproteomics. Proteomics 2011, 11:4677-4687.
59Lee H-J, Na K, Choi E-Y, Kim KS, Kim H, Paik Y-K: Simple Method for Quantitative Analysis of N-Linked Glycoproteins in Hepatocellular Carcinoma Specimens. Journal of Proteome Research 2010, 9:308-318.
60Liu Z, Cao L, He Y, Qiao L, Xu C, Lu H, Yang P: Tandem O-18 Stable Isotope Labeling for Quantification of N-Glycoproteome. Journal of Proteome Research 2010, 9:227-236.
64Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res 2009, 8:651-661.
69Calvano CD, Zambonin CG, Jensen ON: Assessment of lectin and HILIC based enrichment protocols for characterization of serum glycoproteins by mass spectrometry. Journal of Proteomics 2008, 71:304-317.
73Larsen MR, Jensen SS, Jakobsen LA, Heegaard NHH: Exploring the sialiome using titanium dioxide chromatography and mass spectrometry. Molecular & Cellular Proteomics 2007, 6:1778-1787.
76Alvarez-Manilla G, Atwood J, Guo Y, Warren NL, Orlando R, Pierce M: Tools for glycoproteomic analysis: Size exclusion chromatography facilitates identification of tryptic glycopeptides with N-linked glycosylation sites. Journal of Proteome Research 2006, 5:701-708.
79Qiu RQ, Regnier FE: Comparative glycoproteomics of N-linked complex-type glycoforms containing sialic acid in human serum. Analytical Chemistry 2005, 77:7225-7231.
80Qiu RQ, Regnier FE: Use of multidimensional lectin affinity chromatography in differential glycoproteomics. Analytical Chemistry 2005, 77:2802-2809.
81Liu T, Qian WJ, Gritsenko MA, Camp DG, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. Journal of Proteome Research 2005, 4:2070-2080.
82Hagglund P, Bunkenborg J, Elortza F, Jensen ON, Roepstorff P: A new strategy for identification of N-glycosylated proteins and unambiguous assignment of their glycosylation sites using HILIC enrichment and partial deglycosylation. Journal of Proteome Research 2004, 3:556-566.