Contains      

UniProtKB-P19883

Protein Follistatin
Gene FST
Status Reviewed
Source Bladder stromal cell line; Breast Cancer cell lines; Breast cancer xenografts; HepG2 cell line (Liver); HuH-7 cell line (Liver); OVCAR-3 cell line (Ovarian cancer); Ovarian tumor; Prostate stromal cell line; Prostate tumor
Years 2007-2015

Glycosites

Site Identified Peptides Year(Publication ID)
124 CAPDCSnITWKGP 2013(37);
124 CVCAPDCSnITWK 2013(38); 2007(unpublished);2007(unpublished);
288 nATYASECAMK 2015(1);
288 PVCASDnATYASE 2013(37);
288 SDEPVCASDnATYA 2007(unpublished);2007(unpublished);
288 SDEPVCASDnATYASECAMK 2009(65); 2009(65); 2013(34); 2013(34); 2013(38); 2013(38); 2015(unpublished);2015(1); 2015(unpublished);

Sequence

1112131415161718191
MVRARHQPGGLCLLLLLLCQFMEDRSAQAGNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDC
101111121131141151161171181191
GPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPA
201211221231241251261271281291
SSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEA
301311321331341
ACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPISSILEW

Reference

ID Publication
1Sun S, Shah P, Eshghi ST, Yang W, Trikannad N, Yang S, Chen L, Aiyetan P, Hoti N, Zhang Z, et al: Comprehensive analysis of protein glycosylation by solid-phase extraction of N-linked glycans and glycosite-containing peptides. Nat Biotech 2015, advance online publication.
34Sun S, Zhang B, Aiyetan P, Zhou J-Y, Shah P, Yang W, Levine DA, Zhang Z, Chan DW, Zhang H: Analysis of N-glycoproteins using Genomic N-glycosite Prediction. Journal of Proteome Research 2013, 12:5609-5615.
37Boersema PJ, Geiger T, Wisniewski JR, Mann M: Quantification of the N-glycosylated Secretome by Super-SILAC During Breast Cancer Progression and in Human Blood Samples. Molecular & Cellular Proteomics 2013, 12:158-171.
38Kaji H, Ocho M, Togayachi A, Kuno A, Sogabe M, Ohkura T, Nozaki H, Angata T, Chiba Y, Ozaki H, et al: Glycoproteomic Discovery of Serological Biomarker Candidates for HCV/HBV Infection-Associated Liver Fibrosis and Hepatocellular Carcinoma. Journal of Proteome Research 2013, 12:2630-2640.
65Goo YA, Lilu AY, Ryu S, Shaffer SA, Malmstrom L, Page L, Nguyen LT, Doneanu CE, Goodlett DR: Identification of Secreted Glycoproteins of Human Prostate and Bladder Stromal Cells by Comparative Quantitative Proteomics. Prostate 2009, 69:49-61.