Contains      

UniProtKB-P20036

Protein HLA class II histocompatibility antigen, DP alpha 1 chain
Gene HLA-DPA1
Status Reviewed
Source Breast cancer xenografts; Breast tumor; Colorectal tumor; DLBCL cell lines (Diffuse large B-cell lymphoma); Liver; Lymphocytes; Ovarian tumor; Platelet; Prostate; Prostate tumor; Serum; Urine
Years 2007-2015

Glycosites

Site Identified Peptides Year(Publication ID)
109 SnHTQATNDPPE 2014(33);
109 SnHTQATNDPPEVTVFPK 2013(34); 2014(14); 2014(16); 2014(22); 2014(33); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015;2015;2007;2007;2007;2007;
149 FFPPVLnVT 2014(33);
149 ICHIDKFFPPVLnVTW 2014(33);
149 FFPPVLnVTWLCNGELVTEGVAESLFLPR 2009(64); 2007(unpublished);

Sequence

1112131415161718191
MRPEDRMFHIRAVILRALSLAFLLSLRGAGAIKADHVSTYAAFVQTHRPTGEFMFEFDEDEMFYVDLDKKETVWHLEEFGQAFSFEAQGGLANIAILNNN
101111121131141151161171181191
LNTLIQRSNHTQATNDPPEVTVFPKEPVELGQPNTLICHIDKFFPPVLNVTWLCNGELVTEGVAESLFLPRTDYSFHKFHYLTFVPSAEDFYDCRVEHWG
201211221231241251
LDQPLLKHWEAQEPIQMPETTETVLCALGLVLGLVGIIVGTVLIIKSLRSGHDPRAQGTL

Reference

ID Publication
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
16Deeb SJ, Cox J, Schmidt-Supprian M, Mann M: N-linked Glycosylation Enrichment for In-depth Cell Surface Proteomics of Diffuse Large B-cell Lymphoma Subtypes. Molecular & Cellular Proteomics 2014, 13:240-251.
22Nicastri A, Gaspari M, Sacco R, Elia L, Gabriele C, Romano R, Rizzuto A, Cuda G: N-Glycoprotein Analysis Discovers New Up-Regulated Glycoproteins in Colorectal Cancer Tissue. Journal of Proteome Research 2014, 13:4932-4941.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
34Sun S, Zhang B, Aiyetan P, Zhou J-Y, Shah P, Yang W, Levine DA, Zhang Z, Chan DW, Zhang H: Analysis of N-glycoproteins using Genomic N-glycosite Prediction. Journal of Proteome Research 2013, 12:5609-5615.
64Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res 2009, 8:651-661.