Contains      

UniProtKB-P20160

Protein Azurocidin
Gene AZU1
Status Reviewed
Source Bladder tumor; Breast tumor; Colorectal tumor; Liver; Liver tumor (HCC); Lung Adenocarcinoma; Ovarian tumor; Ovarian tumorPBMC Macrophage cells; Plasma; Prostate; Prostate cancer metastasis to liver; Prostate tumor; Saliva; Serum; Urine; lung; ovarian tumor
Years 2007-20072007

Glycosites

Site Identified Peptides Year(Publication ID)
126 EAnLTSSV 2014(14); 2015(unpublished);
126 EAnLTSSVTILPLPLQ 2014(33);
126 AnLTSSVTILPLPLQNATVE 2014(33);
126 EAnLTSSVTILPLPLQNATVE 2014(33);
126 EAnLTSSVTILPLPLQNATVEAGTR 2009(64); 2011(54); 2011(56); 2014(13); 2014(14); 2014(22); 2014(30); 2014(33); 2015(unpublished);2015(unpublished);2015;2015;2015;2007;2007;
140 nATVEAGTR 2014(33); 2015(unpublished);
140 LQnATVEAGTR 2014(14); 2015(unpublished);
140 ILPLPLQnATVE 2014(33);
140 VTILPLPLQnATVE 2014(33);
140 LPLPLQnATVEAGTR 2014(14);
140 ILPLPLQnATVEAGTR 2014(14); 2014(33); 2015(unpublished);
140 SSVTILPLPLQnATVE 2014(33);
140 TILPLPLQnATVEAGTR 2014(14); 2015(unpublished);
140 VTILPLPLQnATVEAGTR 2007(unpublished);
140 ANLTSSVTILPLPLQnATVE 2014(33);
140 EANLTSSVTILPLPLQnATVE 2014(33);
140 EANLTSSVTILPLPLQnATVEAGTR 2009(64); 2011(54); 2011(56); 2014(13); 2014(14); 2014(22); 2014(30); 2014(33); 2015(unpublished);2015(unpublished);2015;2015;2015;2007;2007;
171 FVnVTVTPE 2014(33);
171 FVnVTVTPEDQ 2014(14); 2014(33); 2015(unpublished);
171 FVnVTVTPEDQCR 2014(33); 2015(unpublished);
171 FVnVTVTPEDQCRPN 2014(14); 2014(33); 2015(unpublished);2015(unpublished);
171 FVnVTVTPEDQCRPNNV 2014(14); 2015(unpublished);
171 FVnVTVTPEDQCRPNNVCTGVITR 2014(32);
171 FVnVTVTPEDQCRPNNVCTGVLTR 2007(64); 2009(53); 2012(39); 2013(45); 2013(13); 2014(14); 2014(36); 2014(22); 2014(33); 2014(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(UnpublishedUnpublished ); 2015;2007;2007;2007;2007;2007;20072007 ;

Sequence

1112131415161718191
MTRLTVLALLAGLLASSRAGSSPLLDIVGGRKARPRQFPFLASIQNQGRHFCGGALIHARFVMTAASCFQSQNPGVSTVVLGAYDLRRRERQSRQTFSIS
101111121131141151161171181191
SMSENGYDPQQNLNDLMLLQLDREANLTSSVTILPLPLQNATVEAGTRCQVAGWGSQRSGGRLSRFPRFVNVTVTPEDQCRPNNVCTGVLTRRGGICNGD
201211221231241251
GGTPLVCEGLAHGVASFSLGPCGRGPDFFTRVALFRDWIDGVLNNPGPGPA

Reference

ID Publication
13Yang W, Laeyendecker O, Wendel SK, Zhang B, Sun S, Zhou J-Y, Ao M, Moore RD, Jackson JB, Zhang H: Glycoproteomic Study Reveals Altered Plasma Proteins Associated with HIV Elite Suppressors. Theranostics 2014, 4:1153.
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
22Nicastri A, Gaspari M, Sacco R, Elia L, Gabriele C, Romano R, Rizzuto A, Cuda G: N-Glycoprotein Analysis Discovers New Up-Regulated Glycoproteins in Colorectal Cancer Tissue. Journal of Proteome Research 2014, 13:4932-4941.
30Xu Y, Bailey U-M, Punyadeera C, Schulz BL: Identification of salivary N-glycoproteins and measurement of glycosylation site occupancy by boronate glycoprotein enrichment and liquid chromatography/electrospray ionization tandem mass spectrometry. Rapid Communications in Mass Spectrometry 2014, 28:471-482.
32Zhang Z, Sun Z, Zhu J, Liu J, Huang G, Ye M, Zou H: High-Throughput Determination of the Site-Specific N-Sialoglycan Occupancy Rates by Differential Oxidation of Glycoproteins Followed with Quantitative Glycoproteomics Analysis. Analytical Chemistry 2014, 86:9830-9837.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
36Li QK, Shah P, Li Y, Aiyetan PO, Chen J, Yung R, Molena D, Gabrielson E, Askin F, Chan DW: Glycoproteomic analysis of bronchoalveolar lavage (BAL) fluid identifies tumor-associated glycoproteins from lung adenocarcinoma. Journal of proteome research 2013, 12:3689-3696.
39Li QK, Shah P, Li Y, Aiyetan PO, Chen J, Yung R, Molena D, Gabrielson E, Askin F, Chan DW, Zhang H: Glycoproteomic Analysis of Bronchoalveolar Lavage (BAL) Fluid Identifies Tumor-Associated Glycoproteins from Lung Adenocarcinonna. Journal of Proteome Research 2013, 12:3689-3696.
45Zhou H, Froehlich JW, Briscoe AC, Lee RS: The GlycoFilter: A Simple and Comprehensive Sample Preparation Platform for Proteomics, N-Glycomics and Glycosylation Site Assignment. Molecular & Cellular Proteomics 2013, 12:2981-2991.
53Zhu J, Wang F, Chen R, Cheng K, Xu B, Guo Z, Liang X, Ye M, Zou H: Centrifugation Assisted Microreactor Enables Facile Integration of Trypsin Digestion, Hydrophilic Interaction Chromatography Enrichment, and On-Column Deglycosylation for Rapid and Sensitive N-Glycoproteome Analysis. Analytical Chemistry 2012, 84:5146-5153.
54Tian Y, Yao Z, Roden R, Zhang H: Identification of glycoproteins associated with different histological subtypes of ovarian tumors using quantitative glycoproteomics. Proteomics 2011, 11:4677-4687.
56Bandhakavi S, Van Riper SK, Tawfik PN, Stone MD, Haddad T, Rhodus NL, Carlis JV, Griffin TJ: Hexapeptide Libraries for Enhanced Protein PTM Identification and Relative Abundance Profiling in Whole Human Saliva. Journal of Proteome Research 2011, 10:1052-1061.
64Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res 2009, 8:651-661.