Contains      

UniProtKB-P20851

Protein C4b-binding protein beta chain
Gene C4BPB
Status Reviewed
Source Breast tumor; Colorectal tumor; HCC cell lines (Liver); HepG2 cell line (Liver); HuH-7 cell line (Liver); Human; Liver; Liver tumor (HCC); Ovarian tumor; Pancreatic islets; Plasma; Prostate cancer metastasis to liver; Prostate tumor; Serum; Serum (HCC); Urine; plasma
Years 2004-2015

Glycosites

Site Identified Peptides Year(Publication ID)
64 TLFCnASK 2005( 81); 2007(71); 2013(38); 2013(40); 2013(42); 2014(13); 2014(22); 2014(33); 2015(10); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015;2007;2007;2007;2007;
64 KTLFCnASK 2014(13); 2014(33); 2015(unpublished);2015(4);
64 TLFCnASKE 2014(33);
64 TLFCnASKEWDNTTTECR 2008(69); 2012(53); 2013(38); 2013(38); 2013(38); 2014(13); 2014(35); 2015(unpublished);2015(4);
64 KTLFCnASKEWDNTTTECR 2015(unpublished);2015(4);
64 LFCnASKEWDNTTTECRLGH 2015(6);
71 EWDnTTTECR 2007(71); 2012(48); 2013(38); 2013(38); 2013(42); 2013(45); 2014(13); 2014(22); 2014(32); 2014(33); 2015(4); 2015(8); 2015(10); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2007;2007;2007;2007;
71 TLFCNASKEWDnTTTECR 2008(69); 2012(53); 2013(38); 2013(38); 2013(38); 2014(13); 2014(35); 2015(unpublished);2015(4);
71 KTLFCNASKEWDnTTTECR 2015(unpublished);2015(4);
71 LFCNASKEWDnTTTECRLGH 2015(6);
71 EWDnTTTECRLGHCPDPVLVNGEFSSSGPVNVSDK 2013(38); 2013(38);
98 GPVnVSDK 2014(33); 2015(unpublished);
98 SSSGPVnVSDK 2014(33);
98 FSSSGPVnVSDK 2014(33);
98 GEFSSSGPVnVSDK 2015(unpublished);
98 SSSGPVnVSDKITF 2014(33);
98 FSSSGPVnVSDKITF 2014(33);
98 FSSSGPVnVSDKITFMCND 2013(42);
98 IGHCPDPVIVNGEFSSSGPVnVSDK 2014(32); 2014(32);
98 LGHCPDPVLVNGEFSSSGPVnVSDK 2004( 82); 2005(81); 2007(69); 2008(64); 2009(40); 2010(48); 2012(53); 2012(34); 2013(38); 2013(42); 2013(45); 2013(13); 2014(35); 2014(20); 2014(22); 2014(33); 2014(4); 2015(8); 2015(10); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(Unpublished ); 2007;2007;2007;2007;2007;2007 ;
98 EWDNTTTECRLGHCPDPVLVNGEFSSSGPVnVSDK 2013(38); 2013(38);
98 LGHCPDPVLVNGEFSSSGPVnVSDKITFMCNDHYILK 2015(unpublished);
117 HYILKGSnRSQCLE 2013(42);
154 GNnFTLGSTISY 2014(33);
154 GNnFTLGSTISYY 2014(33);
154 GNnFTLGSTISYYCEDR 2014(33);
154 DCDPPGNPVHGYFEGNnFTLGSTISYYCEDR 2014(13); 2015(10); 2015(unpublished);2007(unpublished);2007;
154 SRDCDPPGNPVHGYFEGNnFTLGSTISYYCEDR 2015(unpublished);

Sequence

1112131415161718191
MFFWCACCLMVAWRVSASDAEHCPELPPVDNSIFVAKEVEGQILGTYVCIKGYHLVGKKTLFCNASKEWDNTTTECRLGHCPDPVLVNGEFSSSGPVNVS
101111121131141151161171181191
DKITFMCNDHYILKGSNRSQCLEDHTWAPPFPICKSRDCDPPGNPVHGYFEGNNFTLGSTISYYCEDRYYLVGVQEQQCVDGEWSSALPVCKLIQEAPKP
201211221231241251
ECEKALLAFQESKNLCEAMENFMQQLKESGMTMEELKYSLELKKAELKAKLL

Reference

ID Publication
4Cheow ESH, Sim KH, de Kleijn D, Lee CN, Sorokin V, Sze SK: Simultaneous Enrichment of Plasma Soluble and Extracellular Vesicular Glycoproteins Using Prolonged Ultracentrifugation-Electrostatic Repulsion-hydrophilic Interaction Chromatography (PUC-ERLIC) Approach. Molecular & Cellular Proteomics 2015, 14:1657-1671.
6Kim DS, Hahn Y: The acquisition of novel N-glycosylation sites in conserved proteins during human evolution. Bmc Bioinformatics 2015, 16.
8Ma C, Zhang Q, Qu JY, Zhao XY, Li X, Liu YP, Wang PG: A precise approach in large scale core-fucosylated glycoprotein identification with low- and high-normalized collision energy. Journal of Proteomics 2015, 114:61-70.
10Tan ZJ, Yin HD, Nie S, Lin ZX, Zhu JH, Ruffin MT, Anderson MA, Simone DM, Lubman DM: Large-Scale Identification of Core-Fucosylated Glycopeptide Sites in Pancreatic Cancer Serum Using Mass Spectrometry. Journal of Proteome Research 2015, 14:1968-1978.
13Yang W, Laeyendecker O, Wendel SK, Zhang B, Sun S, Zhou J-Y, Ao M, Moore RD, Jackson JB, Zhang H: Glycoproteomic Study Reveals Altered Plasma Proteins Associated with HIV Elite Suppressors. Theranostics 2014, 4:1153.
20Kim JY, Oh D, Kim S-K, Kang D, Moon MH: Isotope-Coded Carbamidomethylation for Quantification of N-Glycoproteins with Online Microbore Hollow Fiber Enzyme Reactor-Nanoflow Liquid Chromatography-Tandem Mass Spectrometry. Analytical Chemistry 2014, 86:7650-7657.
22Nicastri A, Gaspari M, Sacco R, Elia L, Gabriele C, Romano R, Rizzuto A, Cuda G: N-Glycoprotein Analysis Discovers New Up-Regulated Glycoproteins in Colorectal Cancer Tissue. Journal of Proteome Research 2014, 13:4932-4941.
32Zhang Z, Sun Z, Zhu J, Liu J, Huang G, Ye M, Zou H: High-Throughput Determination of the Site-Specific N-Sialoglycan Occupancy Rates by Differential Oxidation of Glycoproteins Followed with Quantitative Glycoproteomics Analysis. Analytical Chemistry 2014, 86:9830-9837.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
34Sun S, Zhang B, Aiyetan P, Zhou J-Y, Shah P, Yang W, Levine DA, Zhang Z, Chan DW, Zhang H: Analysis of N-glycoproteins using Genomic N-glycosite Prediction. Journal of Proteome Research 2013, 12:5609-5615.
35Chen J, Shah P, Zhang H: Solid phase extraction of N-linked glycopeptides using hydrazide tip. Analytical chemistry 2013, 85:10670-10674.
38Kaji H, Ocho M, Togayachi A, Kuno A, Sogabe M, Ohkura T, Nozaki H, Angata T, Chiba Y, Ozaki H, et al: Glycoproteomic Discovery of Serological Biomarker Candidates for HCV/HBV Infection-Associated Liver Fibrosis and Hepatocellular Carcinoma. Journal of Proteome Research 2013, 12:2630-2640.
40Li X, Jiang J, Zhao X, Wang J, Han H, Zhao Y, Peng B, Zhong R, Ying W, Qian X: N-glycoproteome Analysis of the Secretome of Human Metastatic Hepatocellular Carcinoma Cell Lines Combining Hydrazide Chemistry, HILIC Enrichment and Mass Spectrometry. Plos One 2013, 8.
42Ma C, Zhao X, Han H, Tong W, Zhang Q, Qin P, Chang C, Peng B, Ying W, Qian X: N-linked glycoproteome profiling of human serum using tandem enrichment and multiple fraction concatenation. Electrophoresis 2013, 34:2440-2450.
45Zhou H, Froehlich JW, Briscoe AC, Lee RS: The GlycoFilter: A Simple and Comprehensive Sample Preparation Platform for Proteomics, N-Glycomics and Glycosylation Site Assignment. Molecular & Cellular Proteomics 2013, 12:2981-2991.
48Danzer C, Eckhardt K, Schmidt A, Fankhauser N, Ribrioux S, Wollscheid B, Mueller L, Schiess R, Zuellig R, Lehmann R, et al: Comprehensive Description of the N-Glycoproteome of Mouse Pancreatic beta-Cells and Human Islets. Journal of Proteome Research 2012, 11:1598-1608.
53Zhu J, Wang F, Chen R, Cheng K, Xu B, Guo Z, Liang X, Ye M, Zou H: Centrifugation Assisted Microreactor Enables Facile Integration of Trypsin Digestion, Hydrophilic Interaction Chromatography Enrichment, and On-Column Deglycosylation for Rapid and Sensitive N-Glycoproteome Analysis. Analytical Chemistry 2012, 84:5146-5153.
64Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res 2009, 8:651-661.
69Calvano CD, Zambonin CG, Jensen ON: Assessment of lectin and HILIC based enrichment protocols for characterization of serum glycoproteins by mass spectrometry. Journal of Proteomics 2008, 71:304-317.
71Hagglund P, Matthiesen R, Elortza F, Hojrup P, Roepstorff P, Jensen ON, Bunkenborg J: An enzymatic deglycosylation scheme enabling identification of core fucosylated N-glycans and O-glycosylation site mapping of human plasma proteins. Journal of Proteome Research 2007, 6:3021-3031.
81Liu T, Qian WJ, Gritsenko MA, Camp DG, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. Journal of Proteome Research 2005, 4:2070-2080.