Contains      

UniProtKB-P21810

Protein Biglycan
Gene BGN
Status Reviewed
Source Breast Cancer cell lines; Breast cancer xenografts; Breast tumor; Cerebrospinal fluid; Colorectal cancer cell line, HCT-116 (colorectal cancer); Colorectal tumor; Colorectal tumors; DLBCL cell lines (Diffuse large B-cell lymphoma); HCC cell lines (Liver); Liver; Liver tumor (HCC); OVCAR-3 cell line (Ovarian cancer); Ovarian tumor; Pancreatic islets; Platelet; Prostate; Prostate stromal cell line; Prostate tumor; Serum; Spermatozoa; Urine; ovarian tumor
Years 2007-2015

Glycosites

Site Identified Peptides Year(Publication ID)
270 MIEnGSLSF 2014(33);
270 nGSLSFLPTLR 2014(33);
270 NQIRMIEnGSL 2014(33);
270 EnGSLSFLPTLR 2014(33);
270 MIEnGSLSFLPT 2014(33);
270 nGSLSFLPTLRE 2014(33);
270 GHNQIRMIEnGSL 2014(33);
270 IEnGSLSFLPTLR 2014(14); 2014(33); 2015(unpublished);
270 MIEnGSLSFLPTL 2014(14); 2014(33); 2015(unpublished);
270 NQIRMIEnGSLSF 2014(33);
270 QIRMIEnGSISFI 2013(37);
270 MIEnGSISFIPTIR 2013(43); 2014(16); 2014(32); 2014(32);
270 MIEnGSLSFLPTLR 2007(64); 2009(68); 2009(54); 2011(55); 2011(3); 2012(48); 2012(34); 2013(40); 2013(45); 2013(14); 2014(22); 2014(33); 2014(1); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015;2015;2007;2007;2007;2007;2007;2007;
270 GHNQIRMIEnGSLSF 2014(33);
270 IEnGSLSFLPTLREL 2014(33);
270 MIEnGSLSFLPTLRE 2014(14); 2014(33); 2015(unpublished);
270 RMIEnGSLSFLPTLR 2015(unpublished);
270 MIEnGSLSFLPTLREL 2014(33);
270 HNQIRMIEnGSLSFLPTLR 2015(unpublished);
270 QIRMIEnGSLSFLPTLREL 2014(33);
270 GHNQIRMIEnGSLSFLPTLREL 2014(33);
270 GLGHNQIRMIEnGSLSFLPTLREL 2014(33);
270 MIEnGSLSFLPTLRELHLDNNKLAR 2014(33);
311 LHSNnITK 2012(48); 2014(14); 2014(33); 2015(unpublished);2015(unpublished);
311 LHSNnITKV 2014(33);
311 YLHSNnITK 2012(3); 2014(14); 2014(33); 2015(unpublished);2015(unpublished);
311 VYLHSNnITK 2014(14); 2014(33); 2015(unpublished);2015(unpublished);
311 HSNnITKVGVN 2014(33);
311 LHSNnITKVGV 2014(33);
311 VVYLHSNnITK 2014(33);
311 LHSNnITKVGVN 2014(33);
311 HSNnITKVGVNDF 2009(64); 2014(33);
311 LHSNnITKVGVND 2014(33);
311 LQVVYLHSNnITK 2014(14);
311 VYIHSNnITKVGV 2013(37);
311 IIQVVYIHSNnITK 2013(43);
311 LHSNnITKVGVNDF 2014(33);
311 LLQVVYLHSNnITK 2007(64); 2009(65); 2009(58); 2011(48); 2012(34); 2013(40); 2013(14); 2014(33); 2014(1); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015;2015;2015;2007;2007;2007;2007;
311 KLLQVVYLHSNnITK 2014(33);
311 HSNnITKVGVNDFCPM 2014(33);
311 LHSNnITKVGVNDFCP 2014(33);
311 LHSNnITKVGVNDFCPM 2014(33);
311 HSNnITKVGVNDFCPMGF 2014(33);
311 LHSNnITKVGVNDFCPMGF 2014(33);
311 VPSGLPDLKLLQVVYLHSNnITK 2014(33);

Sequence

1112131415161718191
MWPLWRLVSLLALSQALPFEQRGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNN
101111121131141151161171181191
DISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGF
201211221231241251261271281291
EPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLARVPSGLPDLK
301311321331341351361
LLQVVYLHSNNITKVGVNDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKK

Reference

ID Publication
1Sun S, Shah P, Eshghi ST, Yang W, Trikannad N, Yang S, Chen L, Aiyetan P, Hoti N, Zhang Z, et al: Comprehensive analysis of protein glycosylation by solid-phase extraction of N-linked glycans and glycosite-containing peptides. Nat Biotech 2015, advance online publication.
3Tian Y, Almaraz RT, Choi CH, Li QK, Saeui C, Li D, Shah P, Bhattacharya R, Yarema KJ, Zhang H: Identification of sialylated glycoproteins from metabolically oligosaccharide engineered pancreatic cells. Clinical proteomics 2015, 12:11.
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
16Deeb SJ, Cox J, Schmidt-Supprian M, Mann M: N-linked Glycosylation Enrichment for In-depth Cell Surface Proteomics of Diffuse Large B-cell Lymphoma Subtypes. Molecular & Cellular Proteomics 2014, 13:240-251.
22Nicastri A, Gaspari M, Sacco R, Elia L, Gabriele C, Romano R, Rizzuto A, Cuda G: N-Glycoprotein Analysis Discovers New Up-Regulated Glycoproteins in Colorectal Cancer Tissue. Journal of Proteome Research 2014, 13:4932-4941.
32Zhang Z, Sun Z, Zhu J, Liu J, Huang G, Ye M, Zou H: High-Throughput Determination of the Site-Specific N-Sialoglycan Occupancy Rates by Differential Oxidation of Glycoproteins Followed with Quantitative Glycoproteomics Analysis. Analytical Chemistry 2014, 86:9830-9837.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
34Sun S, Zhang B, Aiyetan P, Zhou J-Y, Shah P, Yang W, Levine DA, Zhang Z, Chan DW, Zhang H: Analysis of N-glycoproteins using Genomic N-glycosite Prediction. Journal of Proteome Research 2013, 12:5609-5615.
37Boersema PJ, Geiger T, Wisniewski JR, Mann M: Quantification of the N-glycosylated Secretome by Super-SILAC During Breast Cancer Progression and in Human Blood Samples. Molecular & Cellular Proteomics 2013, 12:158-171.
40Li X, Jiang J, Zhao X, Wang J, Han H, Zhao Y, Peng B, Zhong R, Ying W, Qian X: N-glycoproteome Analysis of the Secretome of Human Metastatic Hepatocellular Carcinoma Cell Lines Combining Hydrazide Chemistry, HILIC Enrichment and Mass Spectrometry. Plos One 2013, 8.
43Wang GG, Wu YB, Zhou T, Guo YS, Zheng B, Wang J, Bi Y, Liu FJ, Zhou ZM, Guo XJ, Sha JH: Mapping of the N-Linked Glycoproteome of Human Spermatozoa. Journal of Proteome Research 2013, 12:5750-5759.
45Zhou H, Froehlich JW, Briscoe AC, Lee RS: The GlycoFilter: A Simple and Comprehensive Sample Preparation Platform for Proteomics, N-Glycomics and Glycosylation Site Assignment. Molecular & Cellular Proteomics 2013, 12:2981-2991.
48Danzer C, Eckhardt K, Schmidt A, Fankhauser N, Ribrioux S, Wollscheid B, Mueller L, Schiess R, Zuellig R, Lehmann R, et al: Comprehensive Description of the N-Glycoproteome of Mouse Pancreatic beta-Cells and Human Islets. Journal of Proteome Research 2012, 11:1598-1608.
54Tian Y, Yao Z, Roden R, Zhang H: Identification of glycoproteins associated with different histological subtypes of ovarian tumors using quantitative glycoproteomics. Proteomics 2011, 11:4677-4687.
55Tian Y, Bova GS, Zhang H: Quantitative glycoproteomic analysis of optimal cutting temperature-embedded frozen tissues identifying glycoproteins associated with aggressive prostate cancer. Analytical chemistry 2011, 83:7013-7019.
58Nagano K, Shinkawa T, Kato K, Inomata N, Yabuki N, Haramura M: Distinct cell surface proteome profiling by biotin labeling and glycoprotein capturing. Journal of Proteomics 2011, 74:1985-1993.
64Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res 2009, 8:651-661.
65Goo YA, Lilu AY, Ryu S, Shaffer SA, Malmstrom L, Page L, Nguyen LT, Doneanu CE, Goodlett DR: Identification of Secreted Glycoproteins of Human Prostate and Bladder Stromal Cells by Comparative Quantitative Proteomics. Prostate 2009, 69:49-61.
68Zhang L, Xu Y, Yao H, Xie L, Yao J, Lu H, Yang P: Boronic Acid Functionalized Core-Satellite Composite Nanoparticles for Advanced Enrichment of Glycopeptides and Glycoproteins. Chemistry-a European Journal 2009, 15:10158-10166.