Contains      

UniProtKB-P22792

Protein Carboxypeptidase N subunit 2
Gene CPN2
Status Reviewed
Source Breast tumor; Colorectal tumor; HEK293 cell line (embryonic kidney); HepG2 cell line (Liver); HuH-7 cell line (Liver); Human; Liver; Ovarian tumor; Plasma; Prostate; Prostate cancer metastasis to liver; Prostate tumor; Serum; Serum (Colorectal cancer); Serum (HCC); Urine; ovarian tumor; plasma
Years 2004-2015

Glycosites

Site Identified Peptides Year(Publication ID)
74 AFGSNPnLTK 2004( 82); 2005(81); 2007(71); 2007(73); 2007(40); 2010(54); 2011(53); 2012(38); 2013(38); 2013(38); 2013(38); 2013(42); 2013(45); 2013(45); 2013(13); 2014(14); 2014(21); 2014(22); 2014(31); 2014(33); 2014(10); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015;2007;2007;2007;2007;2007;
74 GSNPnLTKVVF 2014(33);
74 AFGSNPnLTKVVFLNTQLCQFRPDAFGGLPR 2015(unpublished);
111 LEDLEVTGSSFLnLSTNIFSNLTSLGK 2005( 81); 2012(53); 2013(38); 2013(38); 2014(35); 2014(15); 2014(33); 2015(unpublished);2007(unpublished);2007(unpublished);2007(Unpublished ); 2007 ;
119 SnLTSLGK 2014(33);
119 SnLTSLGKL 2014(33);
119 IFSnLTSLGK 2007(unpublished);2014(33);
119 IFSnLTSLGKL 2014(33);
119 SnLTSLGKLTL 2014(33);
119 LEDLEVTGSSFLNLSTNIFSnLTSLGK 2005( 81); 2012(53); 2013(38); 2013(38); 2014(35); 2014(15); 2014(33); 2015(unpublished);2007(unpublished);2007(unpublished);2007(Unpublished ); 2007 ;
228 LFLDSNnISE 2013(42);
228 LDSNnISELPPQVF 2014(33);
228 FLDSNnISELPPQVF 2014(33);
228 SLQELFLDSNnISELPPQVF 2015(6);
228 LGSLQELFLDSNnISELPPQVFSQLFCLER 2005( 81); 2014(35); 2014(15); 2015(11); 2015(unpublished);2007(unpublished);2007;
266 ASLGnLTFL 2014(33);
266 NAITHLPLSIFASLGnLTFLSLQWNMLR 2005( 81); 2015(unpublished);2007(unpublished);2007(Unpublished ); 2007 ;
348 LGSNnLTALHPALF 2014(33);
348 LYLGSNnLTALHPA 2014(33);
348 LYLGSNnLTALHPALF 2014(33);
348 LYLGSNnLTALHPALFQNLSK 2005( 81); 2007(59); 2010(40); 2010(53); 2012(38); 2013(38); 2013(38); 2013(42); 2013(45); 2013(45); 2013(13); 2014(35); 2014(33); 2014(10); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015;2007;2007;2007;2007;2007;
348 LYLGSNnLTALHPALFQNLSKLELLSLSK 2014(13); 2015(unpublished);
359 QnLSKLELL 2014(33);
359 LYLGSNNLTALHPALFQnLSK 2005( 81); 2007(59); 2010(40); 2010(53); 2012(38); 2013(38); 2013(38); 2013(42); 2013(45); 2013(45); 2013(13); 2014(35); 2014(33); 2014(10); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015;2007;2007;2007;2007;2007;
359 LYLGSNNLTALHPALFQnLSKLELLSLSK 2014(13); 2015(unpublished);
518 LQYnASQEWDLR 2007(unpublished);
518 QGSLGLQYnASQEWDLR 2005(81); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);
518 WLNVQLSPQQGSLGLQYnASQEWDLR 2015(unpublished);

Sequence

1112131415161718191
MLPGAWLLWTSLLLLARPAQPCPMGCDCFVQEVFCSDEELATVPLDIPPYTKNIIFVETSFTTLETRAFGSNPNLTKVVFLNTQLCQFRPDAFGGLPRLE
101111121131141151161171181191
DLEVTGSSFLNLSTNIFSNLTSLGKLTLNFNMLEALPEGLFQHLAALESLHLQGNQLQALPRRLFQPLTHLKTLNLAQNLLAQLPEELFHPLTSLQTLKL
201211221231241251261271281291
SNNALSGLPQGVFGKLGSLQELFLDSNNISELPPQVFSQLFCLERLWLQRNAITHLPLSIFASLGNLTFLSLQWNMLRVLPAGLFAHTPCLVGLSLTHNQ
301311321331341351361371381391
LETVAEGTFAHLSNLRSLMLSYNAITHLPAGIFRDLEELVKLYLGSNNLTALHPALFQNLSKLELLSLSKNQLTTLPEGIFDTNYNLFNLALHGNPWQCD
401411421431441451461471481491
CHLAYLFNWLQQYTDRLLNIQTYCAGPAYLKGQVVPALNEKQLVCPVTRDHLGFQVTWPDESKAGGSWDLAVQERAARSQCTYSNPEGTVVLACDQAQCR
501511521531541
WLNVQLSPQQGSLGLQYNASQEWDLRSSCGSLRLTVSIEARAAGP

Reference

ID Publication
6Kim DS, Hahn Y: The acquisition of novel N-glycosylation sites in conserved proteins during human evolution. Bmc Bioinformatics 2015, 16.
10Tan ZJ, Yin HD, Nie S, Lin ZX, Zhu JH, Ruffin MT, Anderson MA, Simone DM, Lubman DM: Large-Scale Identification of Core-Fucosylated Glycopeptide Sites in Pancreatic Cancer Serum Using Mass Spectrometry. Journal of Proteome Research 2015, 14:1968-1978.
11Wang M, Zhang X, Deng C: Facile synthesis of magnetic poly(styrene-co-4-vinylbenzene-boronic acid) microspheres for selective enrichment of glycopeptides. Proteomics 2015, 15:2158-2165.
13Yang W, Laeyendecker O, Wendel SK, Zhang B, Sun S, Zhou J-Y, Ao M, Moore RD, Jackson JB, Zhang H: Glycoproteomic Study Reveals Altered Plasma Proteins Associated with HIV Elite Suppressors. Theranostics 2014, 4:1153.
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
15Chen R, Seebun D, Ye M, Zou H, Figeys D: Site-specific characterization of cell membrane N-glycosylation with integrated hydrophilic interaction chromatography solid phase extraction and LC-MS/MS. Journal of Proteomics 2014, 103:194-203.
21Liu L, Yu M, Zhang Y, Wang C, Lu H: Hydrazide Functionalized Core-Shell Magnetic Nanocomposites for Highly Specific Enrichment of N-Glycopeptides. Acs Applied Materials & Interfaces 2014, 6:7823-7832.
22Nicastri A, Gaspari M, Sacco R, Elia L, Gabriele C, Romano R, Rizzuto A, Cuda G: N-Glycoprotein Analysis Discovers New Up-Regulated Glycoproteins in Colorectal Cancer Tissue. Journal of Proteome Research 2014, 13:4932-4941.
31Zhang L, Jiang H, Yao J, Wang Y, Fang C, Yang P, Lu H: Highly specific enrichment of N-linked glycopeptides based on hydrazide functionalized soluble nanopolymers. Chemical Communications 2014, 50:1027-1029.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
35Chen J, Shah P, Zhang H: Solid phase extraction of N-linked glycopeptides using hydrazide tip. Analytical chemistry 2013, 85:10670-10674.
38Kaji H, Ocho M, Togayachi A, Kuno A, Sogabe M, Ohkura T, Nozaki H, Angata T, Chiba Y, Ozaki H, et al: Glycoproteomic Discovery of Serological Biomarker Candidates for HCV/HBV Infection-Associated Liver Fibrosis and Hepatocellular Carcinoma. Journal of Proteome Research 2013, 12:2630-2640.
40Li X, Jiang J, Zhao X, Wang J, Han H, Zhao Y, Peng B, Zhong R, Ying W, Qian X: N-glycoproteome Analysis of the Secretome of Human Metastatic Hepatocellular Carcinoma Cell Lines Combining Hydrazide Chemistry, HILIC Enrichment and Mass Spectrometry. Plos One 2013, 8.
42Ma C, Zhao X, Han H, Tong W, Zhang Q, Qin P, Chang C, Peng B, Ying W, Qian X: N-linked glycoproteome profiling of human serum using tandem enrichment and multiple fraction concatenation. Electrophoresis 2013, 34:2440-2450.
45Zhou H, Froehlich JW, Briscoe AC, Lee RS: The GlycoFilter: A Simple and Comprehensive Sample Preparation Platform for Proteomics, N-Glycomics and Glycosylation Site Assignment. Molecular & Cellular Proteomics 2013, 12:2981-2991.
53Zhu J, Wang F, Chen R, Cheng K, Xu B, Guo Z, Liang X, Ye M, Zou H: Centrifugation Assisted Microreactor Enables Facile Integration of Trypsin Digestion, Hydrophilic Interaction Chromatography Enrichment, and On-Column Deglycosylation for Rapid and Sensitive N-Glycoproteome Analysis. Analytical Chemistry 2012, 84:5146-5153.
54Tian Y, Yao Z, Roden R, Zhang H: Identification of glycoproteins associated with different histological subtypes of ovarian tumors using quantitative glycoproteomics. Proteomics 2011, 11:4677-4687.
59Lee H-J, Na K, Choi E-Y, Kim KS, Kim H, Paik Y-K: Simple Method for Quantitative Analysis of N-Linked Glycoproteins in Hepatocellular Carcinoma Specimens. Journal of Proteome Research 2010, 9:308-318.
71Hagglund P, Matthiesen R, Elortza F, Hojrup P, Roepstorff P, Jensen ON, Bunkenborg J: An enzymatic deglycosylation scheme enabling identification of core fucosylated N-glycans and O-glycosylation site mapping of human plasma proteins. Journal of Proteome Research 2007, 6:3021-3031.
73Larsen MR, Jensen SS, Jakobsen LA, Heegaard NHH: Exploring the sialiome using titanium dioxide chromatography and mass spectrometry. Molecular & Cellular Proteomics 2007, 6:1778-1787.
81Liu T, Qian WJ, Gritsenko MA, Camp DG, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. Journal of Proteome Research 2005, 4:2070-2080.