Contains      

UniProtKB-P25942

Protein Tumor necrosis factor receptor superfamily member 5
Gene CD40
Status Reviewed
Source Breast cancer cell lines; Breast cancer xenografts; Breast tumor; Colorectal tumor; DLBCL cell lines (Diffuse large B-cell lymphoma); HEK293 cell line (embryonic kidney); Liver; Liver tumor (HCC); Lymphocytes; OVCAR-3 cell line (Ovarian cancer); Ovarian tumor; Platelet; Platelet Plasma membranes; Prostate; Prostate tumor; Urine
Years 2007-2015

Glycosites

Site Identified Peptides Year(Publication ID)
153 FSnVSSAF 2014(33);
153 nVSSAFEK 2015(1);
153 SnVSSAFEK 2014(33);
153 FSnVSSAFEK 2007(33); 2014(unpublished);2007(unpublished);2007;
153 SnVSSAFEKCHPW 2014(33);
153 FSnVSSAFEKCHPW 2014(33);
153 PCPVGFFSnVSSAFEK 2014(33);
153 QIATGVSDTICEPCPVGFFSnVSSAFEK 2014(15); 2014(16); 2014(32); 2014(32); 2014(33); 2015(unpublished);2015(1); 2015(unpublished);
180 DLVVQQAGTnK 2007(74); 2014(14); 2014(22); 2014(33); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2007(unpublished);2007;2007;2007;2007;
180 VVQQAGTnKTDVVCGPQDR 2007(unpublished);2014(33);
180 VVQQAGTnKTDVVCGPQDRL 2014(33);
180 DIVVQQAGTnKTDVVCGPQDR 2014(16);
180 DLVVQQAGTnKTDVVCGPQDR 2014(33); 2015(1);

Sequence

1112131415161718191
MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETD
101111121131141151161171181191
TICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPI
201211221231241251261271
IFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ

Reference

ID Publication
1Sun S, Shah P, Eshghi ST, Yang W, Trikannad N, Yang S, Chen L, Aiyetan P, Hoti N, Zhang Z, et al: Comprehensive analysis of protein glycosylation by solid-phase extraction of N-linked glycans and glycosite-containing peptides. Nat Biotech 2015, advance online publication.
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
15Chen R, Seebun D, Ye M, Zou H, Figeys D: Site-specific characterization of cell membrane N-glycosylation with integrated hydrophilic interaction chromatography solid phase extraction and LC-MS/MS. Journal of Proteomics 2014, 103:194-203.
16Deeb SJ, Cox J, Schmidt-Supprian M, Mann M: N-linked Glycosylation Enrichment for In-depth Cell Surface Proteomics of Diffuse Large B-cell Lymphoma Subtypes. Molecular & Cellular Proteomics 2014, 13:240-251.
22Nicastri A, Gaspari M, Sacco R, Elia L, Gabriele C, Romano R, Rizzuto A, Cuda G: N-Glycoprotein Analysis Discovers New Up-Regulated Glycoproteins in Colorectal Cancer Tissue. Journal of Proteome Research 2014, 13:4932-4941.
32Zhang Z, Sun Z, Zhu J, Liu J, Huang G, Ye M, Zou H: High-Throughput Determination of the Site-Specific N-Sialoglycan Occupancy Rates by Differential Oxidation of Glycoproteins Followed with Quantitative Glycoproteomics Analysis. Analytical Chemistry 2014, 86:9830-9837.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
74Lewandrowski U, Zahedi RP, Moebius J, Walter U, Sickmann A: Enhanced N-glycosylation site analysis of Sialoglycopeptides by strong cation exchange prefractionation applied to platelet plasma membranes. Molecular & Cellular Proteomics 2007, 6:1933-1941.