Contains      

UniProtKB-P29622

Protein Kallistatin
Gene SERPINA4
Status Reviewed
Source Breast tumor; Cerebrospinal fluid; Colorectal tumor; HCC cell lines (Liver); HEK293 cell line (embryonic kidney); HepG2 cell line (Liver); HuH-7 cell line (Liver); Liver; Liver tumor (HCC); Lung Adenocarcinoma; Ovarian tumor; Pancreatic islets; Plasma; Platelet; Prostate; Prostate tumor; Saliva; Serum; Serum (Colorectal cancer); Serum (HCC); Urine; lung; ovarian tumor; plasma
Years 2005-2015

Glycosites

Site Identified Peptides Year(Publication ID)
33 SCSnSSHQQILE 2013(42); 2014(33);
33 HDGESCSnSSHQQILE 2014(33);
33 nSSHQQILETGEGSPSLK 2014(33);
33 SnSSHQQILETGEGSPSLK 2007(unpublished);
33 LHVEHDGESCSnSSHQQILETGEGSPSLK 2014(33);
33 QLHVEHDGESCSnSSHQQILETGEGSPSLK 2015(unpublished);
108 GLGFnLTELSE 2014(33);
108 GFnLTELSESDVH 2014(33);
108 GFnLTELSESDVHR 2014(33);
108 nLTELSESDVHRGF 2014(33);
108 GFnLTELSESDVHRGF 2014(33);
108 GLGFnLTELSESDVHR 2014(33);
108 SQIIEGIGFnITEISESDVHR 2014(32); 2014(32);
108 SQILEGLGFnLTELSESDVHR 2005( 79); 2005(80); 2005(81); 2010(59); 2010(40); 2012(53); 2013(38); 2013(38); 2013(38); 2013(38); 2013(42); 2013(45); 2014(13); 2014(35); 2014(15); 2014(23); 2014(24); 2014(28); 2014(33); 2015(10); 2015(11); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2007;2007;2007;2007;2007;
108 SQILEGLGFnLTELSESDVHRGFQHLLHTLNLPGHGLETR 2015(unpublished);
157 FLnDTMAVYE 2014(33);
157 FInDTMAVYEAK 2014(32); 2014(32);
157 FLnDTMAVYEAK 2005( 81); 2007(71); 2007(59); 2010(40); 2010(54); 2011(56); 2011(48); 2012(53); 2012(38); 2013(38); 2013(38); 2013(38); 2013(39); 2013(40); 2013(42); 2013(45); 2013(13); 2014(14); 2014(36); 2014(21); 2014(22); 2014(24); 2014(31); 2014(33); 2014(7); 2015(8); 2015(10); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015;2007;2007;2007;2007;2007;2007;
157 FLnDTMAVYEAKLFHTNFYDTVGTIQLINDHVK 2015(unpublished);
238 YVDEnTTVR 2014(14);
238 DFYVDEnTTVR 2005( 81); 2007(66); 2009(40); 2010(54); 2011(3); 2012(53); 2012(38); 2013(38); 2013(39); 2013(42); 2013(45); 2013(13); 2014(14); 2014(36); 2014(22); 2014(31); 2014(32); 2014(32); 2014(33); 2014(8); 2015(10); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015;2007;2007;2007;2007;2007;2007;
238 nTTVRVPMMLQDQE 2013(42);
238 TTPKDFYVDEnTTVR 2013(38); 2013(38); 2015(unpublished);2015(unpublished);2015(unpublished);

Sequence

1112131415161718191
MHLIDYLLLLLVGLLALSHGQLHVEHDGESCSNSSHQQILETGEGSPSLKIAPANADFAFRFYYLIASETPGKNIFFSPLSISAAYAMLSLGACSHSRSQ
101111121131141151161171181191
ILEGLGFNLTELSESDVHRGFQHLLHTLNLPGHGLETRVGSALFLSHNLKFLAKFLNDTMAVYEAKLFHTNFYDTVGTIQLINDHVKKETRGKIVDLVSE
201211221231241251261271281291
LKKDVLMVLVNYIYFKALWEKPFISSRTTPKDFYVDENTTVRVPMMLQDQEHHWYLHDRYLPCSVLRMDYKGDATVFFILPNQGKMREIEEVLTPEMLMR
301311321331341351361371381391
WNNLLRKRNFYKKLELHLPKFSISGSYVLDQILPRLGFTDLFSKWADLSGITKQQKLEASKSFHKATLDVDEAGTEAAAATSFAIKFFSAQTNRHILRFN
401411421
RPFLVVIFSTSTQSVLFLGKVVDPTKP

Reference

ID Publication
3Tian Y, Almaraz RT, Choi CH, Li QK, Saeui C, Li D, Shah P, Bhattacharya R, Yarema KJ, Zhang H: Identification of sialylated glycoproteins from metabolically oligosaccharide engineered pancreatic cells. Clinical proteomics 2015, 12:11.
7Li Y, Shah P, De Marzo AM, Van Eyk JE, Lo Q, Chan DW, Zhang H: Identification of Glycoproteins Containing Specific Glycans Using a Lectin-Chemical Method. Analytical Chemistry 2015, 87:4683-4687.
8Ma C, Zhang Q, Qu JY, Zhao XY, Li X, Liu YP, Wang PG: A precise approach in large scale core-fucosylated glycoprotein identification with low- and high-normalized collision energy. Journal of Proteomics 2015, 114:61-70.
10Tan ZJ, Yin HD, Nie S, Lin ZX, Zhu JH, Ruffin MT, Anderson MA, Simone DM, Lubman DM: Large-Scale Identification of Core-Fucosylated Glycopeptide Sites in Pancreatic Cancer Serum Using Mass Spectrometry. Journal of Proteome Research 2015, 14:1968-1978.
11Wang M, Zhang X, Deng C: Facile synthesis of magnetic poly(styrene-co-4-vinylbenzene-boronic acid) microspheres for selective enrichment of glycopeptides. Proteomics 2015, 15:2158-2165.
13Yang W, Laeyendecker O, Wendel SK, Zhang B, Sun S, Zhou J-Y, Ao M, Moore RD, Jackson JB, Zhang H: Glycoproteomic Study Reveals Altered Plasma Proteins Associated with HIV Elite Suppressors. Theranostics 2014, 4:1153.
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
15Chen R, Seebun D, Ye M, Zou H, Figeys D: Site-specific characterization of cell membrane N-glycosylation with integrated hydrophilic interaction chromatography solid phase extraction and LC-MS/MS. Journal of Proteomics 2014, 103:194-203.
21Liu L, Yu M, Zhang Y, Wang C, Lu H: Hydrazide Functionalized Core-Shell Magnetic Nanocomposites for Highly Specific Enrichment of N-Glycopeptides. Acs Applied Materials & Interfaces 2014, 6:7823-7832.
22Nicastri A, Gaspari M, Sacco R, Elia L, Gabriele C, Romano R, Rizzuto A, Cuda G: N-Glycoprotein Analysis Discovers New Up-Regulated Glycoproteins in Colorectal Cancer Tissue. Journal of Proteome Research 2014, 13:4932-4941.
23Pan C, Zhou Y, Dator R, Ginghina C, Zhao Y, Movius J, Peskind E, Zabetian CP, Quinn J, Galasko D, et al: Targeted Discovery and Validation of Plasma Biomarkers of Parkinson's Disease. Journal of Proteome Research 2014, 13:4535-4545.
24Song E, Zhu R, Hammond ZT, Mechref Y: LC-MS/MS Quantitation of Esophagus Disease Blood Serum Glycoproteins by Enrichment with Hydrazide Chemistry and Lectin Affinity Chromatography. Journal of Proteome Research 2014, 13:4808-4820.
28Wang Y, Liu M, Xie L, Fang C, Xiong H, Lu H: Highly Efficient Enrichment Method for Glycopeptide Analyses: Using Specific and Nonspecific Nanoparticles Synergistically. Analytical Chemistry 2014, 86:2057-2064.
31Zhang L, Jiang H, Yao J, Wang Y, Fang C, Yang P, Lu H: Highly specific enrichment of N-linked glycopeptides based on hydrazide functionalized soluble nanopolymers. Chemical Communications 2014, 50:1027-1029.
32Zhang Z, Sun Z, Zhu J, Liu J, Huang G, Ye M, Zou H: High-Throughput Determination of the Site-Specific N-Sialoglycan Occupancy Rates by Differential Oxidation of Glycoproteins Followed with Quantitative Glycoproteomics Analysis. Analytical Chemistry 2014, 86:9830-9837.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
35Chen J, Shah P, Zhang H: Solid phase extraction of N-linked glycopeptides using hydrazide tip. Analytical chemistry 2013, 85:10670-10674.
36Li QK, Shah P, Li Y, Aiyetan PO, Chen J, Yung R, Molena D, Gabrielson E, Askin F, Chan DW: Glycoproteomic analysis of bronchoalveolar lavage (BAL) fluid identifies tumor-associated glycoproteins from lung adenocarcinoma. Journal of proteome research 2013, 12:3689-3696.
38Kaji H, Ocho M, Togayachi A, Kuno A, Sogabe M, Ohkura T, Nozaki H, Angata T, Chiba Y, Ozaki H, et al: Glycoproteomic Discovery of Serological Biomarker Candidates for HCV/HBV Infection-Associated Liver Fibrosis and Hepatocellular Carcinoma. Journal of Proteome Research 2013, 12:2630-2640.
39Li QK, Shah P, Li Y, Aiyetan PO, Chen J, Yung R, Molena D, Gabrielson E, Askin F, Chan DW, Zhang H: Glycoproteomic Analysis of Bronchoalveolar Lavage (BAL) Fluid Identifies Tumor-Associated Glycoproteins from Lung Adenocarcinonna. Journal of Proteome Research 2013, 12:3689-3696.
40Li X, Jiang J, Zhao X, Wang J, Han H, Zhao Y, Peng B, Zhong R, Ying W, Qian X: N-glycoproteome Analysis of the Secretome of Human Metastatic Hepatocellular Carcinoma Cell Lines Combining Hydrazide Chemistry, HILIC Enrichment and Mass Spectrometry. Plos One 2013, 8.
42Ma C, Zhao X, Han H, Tong W, Zhang Q, Qin P, Chang C, Peng B, Ying W, Qian X: N-linked glycoproteome profiling of human serum using tandem enrichment and multiple fraction concatenation. Electrophoresis 2013, 34:2440-2450.
45Zhou H, Froehlich JW, Briscoe AC, Lee RS: The GlycoFilter: A Simple and Comprehensive Sample Preparation Platform for Proteomics, N-Glycomics and Glycosylation Site Assignment. Molecular & Cellular Proteomics 2013, 12:2981-2991.
48Danzer C, Eckhardt K, Schmidt A, Fankhauser N, Ribrioux S, Wollscheid B, Mueller L, Schiess R, Zuellig R, Lehmann R, et al: Comprehensive Description of the N-Glycoproteome of Mouse Pancreatic beta-Cells and Human Islets. Journal of Proteome Research 2012, 11:1598-1608.
53Zhu J, Wang F, Chen R, Cheng K, Xu B, Guo Z, Liang X, Ye M, Zou H: Centrifugation Assisted Microreactor Enables Facile Integration of Trypsin Digestion, Hydrophilic Interaction Chromatography Enrichment, and On-Column Deglycosylation for Rapid and Sensitive N-Glycoproteome Analysis. Analytical Chemistry 2012, 84:5146-5153.
54Tian Y, Yao Z, Roden R, Zhang H: Identification of glycoproteins associated with different histological subtypes of ovarian tumors using quantitative glycoproteomics. Proteomics 2011, 11:4677-4687.
56Bandhakavi S, Van Riper SK, Tawfik PN, Stone MD, Haddad T, Rhodus NL, Carlis JV, Griffin TJ: Hexapeptide Libraries for Enhanced Protein PTM Identification and Relative Abundance Profiling in Whole Human Saliva. Journal of Proteome Research 2011, 10:1052-1061.
59Lee H-J, Na K, Choi E-Y, Kim KS, Kim H, Paik Y-K: Simple Method for Quantitative Analysis of N-Linked Glycoproteins in Hepatocellular Carcinoma Specimens. Journal of Proteome Research 2010, 9:308-318.
66Jia W, Lu Z, Fu Y, Wang H-P, Wang L-H, Chi H, Yuan Z-F, Zheng Z-B, Song L-N, Han H-H, et al: A Strategy for Precise and Large Scale Identification of Core Fucosylated Glycoproteins. Molecular & Cellular Proteomics 2009, 8:913-923.
71Hagglund P, Matthiesen R, Elortza F, Hojrup P, Roepstorff P, Jensen ON, Bunkenborg J: An enzymatic deglycosylation scheme enabling identification of core fucosylated N-glycans and O-glycosylation site mapping of human plasma proteins. Journal of Proteome Research 2007, 6:3021-3031.
80Qiu RQ, Regnier FE: Use of multidimensional lectin affinity chromatography in differential glycoproteomics. Analytical Chemistry 2005, 77:2802-2809.
81Liu T, Qian WJ, Gritsenko MA, Camp DG, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. Journal of Proteome Research 2005, 4:2070-2080.