Contains      

UniProtKB-P31997

Protein Carcinoembryonic antigen-related cell adhesion molecule 8
Gene CEACAM8
Status Reviewed
Source Breast Cancer cell lines; Breast cancer xenografts; Breast tumor; Colorectal tumor; DLBCL cell lines (Diffuse large B-cell lymphoma); LNCap/PC3 cell lines (Prostate cancer); Liver; Ovarian tumor; Pancreatic islets; Prostate; Prostate tumor; Saliva; Serum; Spermatozoa; Urine
Years 2006-2015

Glycosites

Site Identified Peptides Year(Publication ID)
104 ETIYPnASLL 2014(33);
104 ETIYPnASLLMR 2011(56); 2014(33); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);
104 SNRETIYPnASLL 2014(33);
111 MRnVTRNDTGSY 2014(33);
111 nVTRNDTGSYTLQVIK 2015(unpublished);2015(unpublished);
115 MRNVTRnDTGSY 2014(33);
115 nDTGSYTLQVIK 2007(33); 2014(unpublished);2015(unpublished);2015;2007;2007;
115 NVTRnDTGSYTLQVIK 2015(unpublished);2015(unpublished);
152 SnNSNPVEDK 2014(33);
152 ISSnNSNPVEDKDA 2009(64);
152 PKPSISSnNSNPVE 2009(64);
152 PSISSnNSNPVEDK 2012(48); 2014(33); 2007(unpublished);2007(unpublished);
152 ISSnNSNPVEDKDAVAF 2014(33);
152 SVHPETPKPSISSnNSNPVEDKDAVAF 2014(33);
152 SEEVTGQFSVHPETPKPSISSnNSNPVEDK 2007(unpublished);2007(unpublished);
173 DAVAFTCEPETQnTTYLWWVNGQSLPVSPR 2007(unpublished);2007(unpublished);
197 SNGnRTL 2014(33);
197 IQISNGnR 2014(16);
197 LQLSNGnR 2014(33); 2015(2); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);
197 LSNGnRTL 2014(33);
197 LQLSNGnRTL 2014(33);
197 SNGnRTLTLL 2014(33);
197 IQISNGnRTITII 2013(37);
197 LQLSNGnRTLTLL 2014(33);
197 LQLSNGnRTLTLLSVTR 2014(33);
274 SVnGTFQQY 2014(33);
274 SWSVnGTFQQY 2014(33);
288 IFIPnITTK 2013(43);
288 LFIPnITTK 2006(77); 2014(14); 2014(22); 2014(33); 2015(unpublished);2015(unpublished);2015(unpublished);

Sequence

1112131415161718191
MGPISAPSCRWRIPWQGLLLTASLFTFWNPPTTAQLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRET
101111121131141151161171181191
IYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTL
201211221231241251261271281291
TLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACH
301311321331341
TTNSATGRNRTTVRMITVSDALVQGSSPGLSARATVSIMIGVLARVALI

Reference

ID Publication
2Shah P, Wang X, Yang W, Eshghi ST, Sun S, Hoti N, Chen L, Yang S, Pasay J, Rubin A: Integrated Proteomic and Glycoproteomic Analyses of Prostate Cancer Cells Reveal Glycoprotein Alteration in Protein Abundance and Glycosylation. Molecular & Cellular Proteomics 2015, 14:2753-2763.
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
16Deeb SJ, Cox J, Schmidt-Supprian M, Mann M: N-linked Glycosylation Enrichment for In-depth Cell Surface Proteomics of Diffuse Large B-cell Lymphoma Subtypes. Molecular & Cellular Proteomics 2014, 13:240-251.
22Nicastri A, Gaspari M, Sacco R, Elia L, Gabriele C, Romano R, Rizzuto A, Cuda G: N-Glycoprotein Analysis Discovers New Up-Regulated Glycoproteins in Colorectal Cancer Tissue. Journal of Proteome Research 2014, 13:4932-4941.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
37Boersema PJ, Geiger T, Wisniewski JR, Mann M: Quantification of the N-glycosylated Secretome by Super-SILAC During Breast Cancer Progression and in Human Blood Samples. Molecular & Cellular Proteomics 2013, 12:158-171.
43Wang GG, Wu YB, Zhou T, Guo YS, Zheng B, Wang J, Bi Y, Liu FJ, Zhou ZM, Guo XJ, Sha JH: Mapping of the N-Linked Glycoproteome of Human Spermatozoa. Journal of Proteome Research 2013, 12:5750-5759.
48Danzer C, Eckhardt K, Schmidt A, Fankhauser N, Ribrioux S, Wollscheid B, Mueller L, Schiess R, Zuellig R, Lehmann R, et al: Comprehensive Description of the N-Glycoproteome of Mouse Pancreatic beta-Cells and Human Islets. Journal of Proteome Research 2012, 11:1598-1608.
56Bandhakavi S, Van Riper SK, Tawfik PN, Stone MD, Haddad T, Rhodus NL, Carlis JV, Griffin TJ: Hexapeptide Libraries for Enhanced Protein PTM Identification and Relative Abundance Profiling in Whole Human Saliva. Journal of Proteome Research 2011, 10:1052-1061.
64Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res 2009, 8:651-661.
77Ramachandran P, Boontheung P, Xie YM, Sondej M, Wong DT, Loo JA: Identification of N-linked glycoproteins in human saliva by glycoprotein capture and mass spectrometry. Journal of Proteome Research 2006, 5:1493-1503.