Contains      

UniProtKB-P32970

Protein CD70 antigen
Gene CD70
Status Reviewed
Source Breast cell lines; DLBCL cell lines (Diffuse large B-cell lymphoma); FTC-133 Cell Line (Thyroid Cance); HEK293 cell line (embryonic kidney); Hela cell line (cervical cancer); Hela cell line (cervical cancer)PBMC Macrophage cells; Ovarian cancer cell lines; Ovarian tumor; Ovarian tumorJurkat T cell line; Prostate tumor; SKOV-3 cell line (Ovarian cancer); Serum; XTC-1 Cell Line (Thyroid Cance)
Years 2007-2015

Glycosites

Site Identified Peptides Year(Publication ID)
63 FAQAQQQIPIESIGWDVAEIQInHTGPQQDPR 2014(16);
63 FAQAQQQLPLESLGWDVAELQLnHTGPQQDPR 2009(62); 2012(52);
170 GDTICTnITGTIIPSR 2014(16);
170 GDTLCTnLTGTLLPSR 2009(62); 2009(62); 2012(52); 2013(34); 2013(34); 2014(13); 2014(15); 2014(17); 2015(12); 2015(unpublished);2007(unpublished);2007(unpublished);2007(unpublished);2007;

Sequence

1112131415161718191
MPEEGSGCSVRRRPYGCVLRAALVPLVAGLVICLVVCIQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHR
101111121131141151161171181191
DGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP

Reference

ID Publication
12Weng Y, Sui Z, Jiang H, Shan Y, Chen L, Zhang S, Zhang L, Zhang Y: Releasing N-glycan from Peptide N-terminus by N-terminal Succinylation Assisted Enzymatic Deglycosylation. Scientific Reports 2015, 5.
13Yang W, Laeyendecker O, Wendel SK, Zhang B, Sun S, Zhou J-Y, Ao M, Moore RD, Jackson JB, Zhang H: Glycoproteomic Study Reveals Altered Plasma Proteins Associated with HIV Elite Suppressors. Theranostics 2014, 4:1153.
15Chen R, Seebun D, Ye M, Zou H, Figeys D: Site-specific characterization of cell membrane N-glycosylation with integrated hydrophilic interaction chromatography solid phase extraction and LC-MS/MS. Journal of Proteomics 2014, 103:194-203.
16Deeb SJ, Cox J, Schmidt-Supprian M, Mann M: N-linked Glycosylation Enrichment for In-depth Cell Surface Proteomics of Diffuse Large B-cell Lymphoma Subtypes. Molecular & Cellular Proteomics 2014, 13:240-251.
17Fang C, Xiong Z, Qin H, Huang G, Liu J, Ye M, Feng S, Zou H: One-pot synthesis of magnetic colloidal nanocrystal clusters coated with chitosan for selective enrichment of glycopeptides. Analytica Chimica Acta 2014, 841:99-105.
34Sun S, Zhang B, Aiyetan P, Zhou J-Y, Shah P, Yang W, Levine DA, Zhang Z, Chan DW, Zhang H: Analysis of N-glycoproteins using Genomic N-glycosite Prediction. Journal of Proteome Research 2013, 12:5609-5615.
52Yen T-Y, Macher BA, McDonald CA, Alleyne-Chin C, Timpe LC: Glycoprotein Profiles of Human Breast Cells Demonstrate a Clear Clustering of Normal/Benign versus Malignant Cell Lines and Basal versus Luminal Cell Lines. Journal of Proteome Research 2012, 11:656-667.
62Arcinas A, Yen T-Y, Kebebew E, Macher BA: Cell Surface and Secreted Protein Profiles of Human Thyroid Cancer Cell Lines Reveal Distinct Glycoprotein Patterns. Journal of Proteome Research 2009, 8:3958-3968.