Contains      

UniProtKB-P38571

Protein Lysosomal acid lipase/cholesteryl ester hydrolase
Gene LIPA
Status Reviewed
Source 22Rv1 cell xenograft (prostate cancer); Breast Cancer cell lines; Breast cancer xenografts; Colorectal tumor; DLBCL cell lines (Diffuse large B-cell lymphoma); HCC cell lines (Liver); HEK293T cell line (embryonic kidney); Hela cell line (cervical cancer); HepG2 cell line (Liver); HuH-7 cell line (Liver); LNCap/PC3 cell lines (Prostate cancer); Liver; Liver tumor (HCC); Lung tumor; OVCAR-3 cell line (Ovarian cancer); Ovarian tumor; Pancreatic islets; Platelet; Prostate tumor; Serum; SpermatozoaJurkat T cell line; Urine
Years 2007-2015

Glycosites

Site Identified Peptides Year(Publication ID)
36 TNMnVSE 2014(33);
36 nVSEIISYW 2014(33);
36 VDPETNMnVSE 2014(33);
36 AVDPETNMnVSE 2014(33);
36 TAVDPETNMnVSE 2014(33);
36 LTAVDPETNMnVSE 2014(33);
36 DPETNMnVSEIISYW 2014(33);
36 VDPETNMnVSEIISY 2014(33);
36 AVDPETNMnVSEIISY 2014(33);
36 VDPETNMnVSEIISYW 2014(33);
36 AVDPETNMnVSEIISYW 2014(33);
101 VTNLAnSSL 2014(33);
101 VTNLAnSSLGF 2014(33);
101 LQHGLLADSSNWVTNLAnSSLGF 2014(33);
101 GPKPVVFLQHGLLADSSNWVTNLAnSSLGFILADAGFDVWMGNSR 2015(unpublished);
161 ILnKTGQEQ 2009(64); 2014(33);
161 ILnKTGQEQV 2014(33);
161 ILnKTGQEQVY 2014(33);
161 DLPASINFILnK 2014(33);
161 ILnKTGQEQVYY 2014(33);
161 SINFIInKTGQEQ 2013(37);
161 YDIPASINFIInK 2014(16); 2014(32); 2014(32);
161 YDLPASINFILnK 2007(57); 2011(48); 2012(49); 2012(50); 2012(34); 2013(38); 2013(38); 2013(40); 2013(45); 2013(33); 2014(1); 2015(2); 2015(unpublished);2015(unpublished);2015;2015;2015;2015;2015;2007;2007;
161 YDLPASINFILnKT 2013(38);
161 MAKYDLPASINFILnK 2014(33);
273 NLnMSR 2013(40); 2014(22); 2014(33); 2015(unpublished);2015(12);
273 nMSRVDVY 2014(33);
273 NLnMSRVDVY 2011(57); 2014(33);
273 ERNLnMSRVDVY 2014(33);
273 LLCGFNERNLnM 2014(33);
273 NERNLnMSRVDVY 2014(33);
273 LLCGFNERNLnMSRVDVY 2014(33);
321 HYnQSYPPTY 2014(33);
321 FHYnQSYPPTY 2014(33);
321 nQSYPPTYNVK 2015(1);
321 FHYnQSYPPTYN 2009(64);
321 HYnQSYPPTYNVK 2014(33);
321 KNYFHYnQSYPPT 2013(37);
321 NYFHYnQSYPPTY 2014(33);
321 FHYnQSYPPTYNVK 2014(33);
321 NYFHYnQSYPPTYNVK 2007(64); 2009(57); 2011(48); 2012(38); 2013(38); 2013(40); 2013(43); 2013(13); 2014(16); 2014(22); 2014(32); 2014(32); 2014(33); 2014(2); 2015(12); 2015(unpublished);2015(unpublished);2015;2015;2015;2015;2015;2007;2007;
321 HYnQSYPPTYNVKDMLVPTAVW 2014(33);
321 FHYnQSYPPTYNVKDMLVPTAVW 2014(33);

Sequence

1112131415161718191
MKMRFLGLVVCLVLWTLHSEGSGGKLTAVDPETNMNVSEIISYWGFPSEEYLVETEDGYILCLNRIPHGRKNHSDKGPKPVVFLQHGLLADSSNWVTNLA
101111121131141151161171181191
NSSLGFILADAGFDVWMGNSRGNTWSRKHKTLSVSQDEFWAFSYDEMAKYDLPASINFILNKTGQEQVYYVGHSQGTTIGFIAFSQIPELAKRIKMFFAL
201211221231241251261271281291
GPVASVAFCTSPMAKLGRLPDHLIKDLFGDKEFLPQSAFLKWLGTHVCTHVILKELCGNLCFLLCGFNERNLNMSRVDVYTTHSPAGTSVQNMLHWSQAV
301311321331341351361371381391
KFQKFQAFDWGSSAKNYFHYNQSYPPTYNVKDMLVPTAVWSGGHDWLADVYDVNILLTQITNLVFHESIPEWEHLDFIWGLDAPWRLYNKIINLMRKYQ

Reference

ID Publication
1Sun S, Shah P, Eshghi ST, Yang W, Trikannad N, Yang S, Chen L, Aiyetan P, Hoti N, Zhang Z, et al: Comprehensive analysis of protein glycosylation by solid-phase extraction of N-linked glycans and glycosite-containing peptides. Nat Biotech 2015, advance online publication.
2Shah P, Wang X, Yang W, Eshghi ST, Sun S, Hoti N, Chen L, Yang S, Pasay J, Rubin A: Integrated Proteomic and Glycoproteomic Analyses of Prostate Cancer Cells Reveal Glycoprotein Alteration in Protein Abundance and Glycosylation. Molecular & Cellular Proteomics 2015, 14:2753-2763.
12Weng Y, Sui Z, Jiang H, Shan Y, Chen L, Zhang S, Zhang L, Zhang Y: Releasing N-glycan from Peptide N-terminus by N-terminal Succinylation Assisted Enzymatic Deglycosylation. Scientific Reports 2015, 5.
13Yang W, Laeyendecker O, Wendel SK, Zhang B, Sun S, Zhou J-Y, Ao M, Moore RD, Jackson JB, Zhang H: Glycoproteomic Study Reveals Altered Plasma Proteins Associated with HIV Elite Suppressors. Theranostics 2014, 4:1153.
16Deeb SJ, Cox J, Schmidt-Supprian M, Mann M: N-linked Glycosylation Enrichment for In-depth Cell Surface Proteomics of Diffuse Large B-cell Lymphoma Subtypes. Molecular & Cellular Proteomics 2014, 13:240-251.
22Nicastri A, Gaspari M, Sacco R, Elia L, Gabriele C, Romano R, Rizzuto A, Cuda G: N-Glycoprotein Analysis Discovers New Up-Regulated Glycoproteins in Colorectal Cancer Tissue. Journal of Proteome Research 2014, 13:4932-4941.
32Zhang Z, Sun Z, Zhu J, Liu J, Huang G, Ye M, Zou H: High-Throughput Determination of the Site-Specific N-Sialoglycan Occupancy Rates by Differential Oxidation of Glycoproteins Followed with Quantitative Glycoproteomics Analysis. Analytical Chemistry 2014, 86:9830-9837.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
34Sun S, Zhang B, Aiyetan P, Zhou J-Y, Shah P, Yang W, Levine DA, Zhang Z, Chan DW, Zhang H: Analysis of N-glycoproteins using Genomic N-glycosite Prediction. Journal of Proteome Research 2013, 12:5609-5615.
37Boersema PJ, Geiger T, Wisniewski JR, Mann M: Quantification of the N-glycosylated Secretome by Super-SILAC During Breast Cancer Progression and in Human Blood Samples. Molecular & Cellular Proteomics 2013, 12:158-171.
38Kaji H, Ocho M, Togayachi A, Kuno A, Sogabe M, Ohkura T, Nozaki H, Angata T, Chiba Y, Ozaki H, et al: Glycoproteomic Discovery of Serological Biomarker Candidates for HCV/HBV Infection-Associated Liver Fibrosis and Hepatocellular Carcinoma. Journal of Proteome Research 2013, 12:2630-2640.
40Li X, Jiang J, Zhao X, Wang J, Han H, Zhao Y, Peng B, Zhong R, Ying W, Qian X: N-glycoproteome Analysis of the Secretome of Human Metastatic Hepatocellular Carcinoma Cell Lines Combining Hydrazide Chemistry, HILIC Enrichment and Mass Spectrometry. Plos One 2013, 8.
43Wang GG, Wu YB, Zhou T, Guo YS, Zheng B, Wang J, Bi Y, Liu FJ, Zhou ZM, Guo XJ, Sha JH: Mapping of the N-Linked Glycoproteome of Human Spermatozoa. Journal of Proteome Research 2013, 12:5750-5759.
45Zhou H, Froehlich JW, Briscoe AC, Lee RS: The GlycoFilter: A Simple and Comprehensive Sample Preparation Platform for Proteomics, N-Glycomics and Glycosylation Site Assignment. Molecular & Cellular Proteomics 2013, 12:2981-2991.
48Danzer C, Eckhardt K, Schmidt A, Fankhauser N, Ribrioux S, Wollscheid B, Mueller L, Schiess R, Zuellig R, Lehmann R, et al: Comprehensive Description of the N-Glycoproteome of Mouse Pancreatic beta-Cells and Human Islets. Journal of Proteome Research 2012, 11:1598-1608.
49Kim JY, Kim S-K, Kang D, Moon MH: Dual Lectin-Based Size Sorting Strategy to Enrich Targeted N-Glycopeptides by Asymmetrical Flow Field-Flow Fractionation: Profiling Lung Cancer Biomarkers. Analytical Chemistry 2012, 84:5343-5350.
50Whitmore TE, Peterson A, Holzman T, Eastham A, Amon L, McIntosh M, Ozinsky A, Nelson PS, Martin DB: Integrative Analysis of N-Linked Human Glycoproteomic Data Sets Reveals PTPRF Ectodomain as a Novel Plasma Biomarker Candidate for Prostate Cancer. Journal of Proteome Research 2012, 11:2653-2665.
57Chen Y, Cao J, Yan G, Lu H, Yang P: Two-step protease digestion and glycopeptide capture approach for accurate glycosite identification and glycoprotein sequence coverage improvement. Talanta 2011, 85:70-75.
64Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res 2009, 8:651-661.