Contains      

UniProtKB-P43121

Protein Cell surface glycoprotein MUC18
Gene MCAM
Status Reviewed
Source Breast Cancer cell lines; Breast cancer xenografts; Breast cell lines; Breast tumor; Cerebrospinal fluid; Colorectal cancer cell line, HCT-116 (colorectal cancer); DLBCL cell lines (Diffuse large B-cell lymphoma); DRO-1 Cell Line (Thyroid Cance); HEK293 cell line (embryonic kidney); HEK293T cell line (embryonic kidney); HEK293T cell line (embryonic kidney), HEK293T cell line (embryonic kidney); HeLa cell line (Cervical cancer); Hela cell line (cervical cancer); HuH-7 cell line (Liver); K562A cell line (Leukemia); K562S cell line (Leukemia); Liver; Liver tumor (HCC); Ovarian tumor; Pancreatic islets; Plasma; Prostate; Prostate tumor; Serum; TPC-1 Cell Line (Thyroid Cance); Urine; plasma
Years 2007-2015

Glycosites

Site Identified Peptides Year(Publication ID)
56 SQSQGnLSHVDW 2014(33);
56 ISQSQGnISHVDW 2013(37);
56 SQSQGnLSHVDWF 2014(33);
56 CGISQSQGnISHVDWFSVHK 2014(16); 2014(32);
56 CGLSQSQGnLSHVDWFSVHK 2007(62); 2009(62); 2009(67); 2009(58); 2011(52); 2012(38); 2013(45); 2013(45); 2013(15); 2014(33); 2014(8); 2015(9); 2015(10); 2015(12); 2015(unpublished);2015(unpublished);2015;2015;2015;2015;2007;2007;
56 CGLSQSQGnLSHVDWFSVHKEK 2011(58);
56 CGLSQSQGnLSHVDWFSVHKEKR 2011(58);
418 CVASVPSIPGInR 2014(16);
418 CVASVPSIPGLnR 2007(45); 2013(15); 2014(25); 2014(25); 2014(33); 2014(unpublished);2015(unpublished);2015;2015;2007;2007;
418 PSIPGInRTQIVN 2013(37);
418 SVPSIPGLnRTQL 2014(33);
418 RCVASVPSIPGLnRTQL 2014(33);
449 NMVLnLSCE 2014(33);
449 KENMVInISCEAS 2013(37);
449 ENMVInISCEASGHPR 2014(16);
449 ENMVLnLSCEASGHPR 2007(3); 2012(48); 2012(14); 2014(25); 2014(33); 2014(unpublished);2015(unpublished);2007(unpublished);2007;2007;
449 VWVKENMVInISCEASGHPR 2014(16);
449 ENMVLnLSCEASGHPRPTISWNVNGTASEQDQDPQR 2012(52); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);
467 NVnGTASEQDQDPQR 2011(57); 2012(3); 2007(unpublished);2007(unpublished);2007(unpublished);
467 NVnGTASEQDQDPQRVL 2014(33);
467 ISWNVnGTASEQDQDPQR 2009(64);
467 PTISWNVnGTASEQDQDPQR 2014(33); 2015(unpublished);
467 ASGHPRPTISWNVnGTASEQDQDPQR 2014(33);
467 ENMVLNLSCEASGHPRPTISWNVnGTASEQDQDPQR 2012(52); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);
508 nTSILFLE 2014(33);
508 LGKnTSILFLE 2013(42);
508 CTASNDLGKnTSILFLE 2014(33);
544 AnSTSTER 2015(unpublished);

Sequence

1112131415161718191
MGLPRLVCAFLLAACCCCPRVAGVPGEAEQPAPELVEVEVGSTALLKCGLSQSQGNLSHVDWFSVHKEKRTLIFRVRQGQGQSEPGEYEQRLSLQDRGAT
101111121131141151161171181191
LALTQVTPQDERIFLCQGKRPRSQEYRIQLRVYKAPEEPNIQVNPLGIPVNSKEPEEVATCVGRNGYPIPQVIWYKNGRPLKEEKNRVHIQSSQTVESSG
201211221231241251261271281291
LYTLQSILKAQLVKEDKDAQFYCELNYRLPSGNHMKESREVTVPVFYPTEKVWLEVEPVGMLKEGDRVEIRCLADGNPPPHFSISKQNPSTREAEEETTN
301311321331341351361371381391
DNGVLVLEPARKEHSGRYECQGLDLDTMISLLSEPQELLVNYVSDVRVSPAAPERQEGSSLTLTCEAESSQDLEFQWLREETGQVLERGPVLQLHDLKRE
401411421431441451461471481491
AGGGYRCVASVPSIPGLNRTQLVNVAIFGPPWMAFKERKVWVKENMVLNLSCEASGHPRPTISWNVNGTASEQDQDPQRVLSTLNVLVTPELLETGVECT
501511521531541551561571581591
ASNDLGKNTSILFLELVNLTTLTPDSNTTTGLSTSTASPHTRANSTSTERKLPEPESRGVVIVAVIVCILVLAVLGAVLYFLYKKGKLPCRRSGKQEITL
601611621631641
PPSRKSELVVEVKSDKLPEEMGLLQGSSGDKRAPGDQGEKYIDLRH

Reference

ID Publication
3Tian Y, Almaraz RT, Choi CH, Li QK, Saeui C, Li D, Shah P, Bhattacharya R, Yarema KJ, Zhang H: Identification of sialylated glycoproteins from metabolically oligosaccharide engineered pancreatic cells. Clinical proteomics 2015, 12:11.
8Ma C, Zhang Q, Qu JY, Zhao XY, Li X, Liu YP, Wang PG: A precise approach in large scale core-fucosylated glycoprotein identification with low- and high-normalized collision energy. Journal of Proteomics 2015, 114:61-70.
9Smeekens JM, Chen WX, Wu RH: Mass Spectrometric Analysis of the Cell Surface N-Glycoproteome by Combining Metabolic Labeling and Click Chemistry. Journal of the American Society for Mass Spectrometry 2015, 26:604-614.
10Tan ZJ, Yin HD, Nie S, Lin ZX, Zhu JH, Ruffin MT, Anderson MA, Simone DM, Lubman DM: Large-Scale Identification of Core-Fucosylated Glycopeptide Sites in Pancreatic Cancer Serum Using Mass Spectrometry. Journal of Proteome Research 2015, 14:1968-1978.
12Weng Y, Sui Z, Jiang H, Shan Y, Chen L, Zhang S, Zhang L, Zhang Y: Releasing N-glycan from Peptide N-terminus by N-terminal Succinylation Assisted Enzymatic Deglycosylation. Scientific Reports 2015, 5.
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
15Chen R, Seebun D, Ye M, Zou H, Figeys D: Site-specific characterization of cell membrane N-glycosylation with integrated hydrophilic interaction chromatography solid phase extraction and LC-MS/MS. Journal of Proteomics 2014, 103:194-203.
16Deeb SJ, Cox J, Schmidt-Supprian M, Mann M: N-linked Glycosylation Enrichment for In-depth Cell Surface Proteomics of Diffuse Large B-cell Lymphoma Subtypes. Molecular & Cellular Proteomics 2014, 13:240-251.
25Sun Z, Dong J, Zhang S, Hu Z, Cheng K, Li K, Xu B, Ye M, Nie Y, Fan D, Zou H: Identification of Chemoresistance-Related Cell-Surface Glycoproteins in Leukemia Cells and Functional Validation of Candidate Glycoproteins. Journal of Proteome Research 2014, 13:1593-1601.
32Zhang Z, Sun Z, Zhu J, Liu J, Huang G, Ye M, Zou H: High-Throughput Determination of the Site-Specific N-Sialoglycan Occupancy Rates by Differential Oxidation of Glycoproteins Followed with Quantitative Glycoproteomics Analysis. Analytical Chemistry 2014, 86:9830-9837.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
37Boersema PJ, Geiger T, Wisniewski JR, Mann M: Quantification of the N-glycosylated Secretome by Super-SILAC During Breast Cancer Progression and in Human Blood Samples. Molecular & Cellular Proteomics 2013, 12:158-171.
38Kaji H, Ocho M, Togayachi A, Kuno A, Sogabe M, Ohkura T, Nozaki H, Angata T, Chiba Y, Ozaki H, et al: Glycoproteomic Discovery of Serological Biomarker Candidates for HCV/HBV Infection-Associated Liver Fibrosis and Hepatocellular Carcinoma. Journal of Proteome Research 2013, 12:2630-2640.
42Ma C, Zhao X, Han H, Tong W, Zhang Q, Qin P, Chang C, Peng B, Ying W, Qian X: N-linked glycoproteome profiling of human serum using tandem enrichment and multiple fraction concatenation. Electrophoresis 2013, 34:2440-2450.
45Zhou H, Froehlich JW, Briscoe AC, Lee RS: The GlycoFilter: A Simple and Comprehensive Sample Preparation Platform for Proteomics, N-Glycomics and Glycosylation Site Assignment. Molecular & Cellular Proteomics 2013, 12:2981-2991.
48Danzer C, Eckhardt K, Schmidt A, Fankhauser N, Ribrioux S, Wollscheid B, Mueller L, Schiess R, Zuellig R, Lehmann R, et al: Comprehensive Description of the N-Glycoproteome of Mouse Pancreatic beta-Cells and Human Islets. Journal of Proteome Research 2012, 11:1598-1608.
52Yen T-Y, Macher BA, McDonald CA, Alleyne-Chin C, Timpe LC: Glycoprotein Profiles of Human Breast Cells Demonstrate a Clear Clustering of Normal/Benign versus Malignant Cell Lines and Basal versus Luminal Cell Lines. Journal of Proteome Research 2012, 11:656-667.
57Chen Y, Cao J, Yan G, Lu H, Yang P: Two-step protease digestion and glycopeptide capture approach for accurate glycosite identification and glycoprotein sequence coverage improvement. Talanta 2011, 85:70-75.
58Nagano K, Shinkawa T, Kato K, Inomata N, Yabuki N, Haramura M: Distinct cell surface proteome profiling by biotin labeling and glycoprotein capturing. Journal of Proteomics 2011, 74:1985-1993.
62Arcinas A, Yen T-Y, Kebebew E, Macher BA: Cell Surface and Secreted Protein Profiles of Human Thyroid Cancer Cell Lines Reveal Distinct Glycoprotein Patterns. Journal of Proteome Research 2009, 8:3958-3968.
64Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res 2009, 8:651-661.
67McDonald CA, Yang JY, Marathe V, Yen T-Y, Macher BA: Combining Results from Lectin Affinity Chromatography and Glycocapture Approaches Substantially Improves the Coverage of the Glycoproteome. Molecular & Cellular Proteomics 2009, 8:287-301.