Contains      

UniProtKB-P46977

Protein Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A
Gene STT3A
Status Reviewed
Source Breast Cancer cell lines; Breast cancer cell lines; Breast cancer xenografts; Breast tumor; Colorectal cancer cell line, HCT-116 (colorectal cancer); Colorectal tumor; DLBCL cell lines (Diffuse large B-cell lymphoma); HCC cell lines (Liver)Jurkat T cell line; HEK293 cell line (embryonic kidney); HEK293T cell line (embryonic kidney); HEK293T cell line (embryonic kidney), HEK293T cell line (embryonic kidney); Hela cell line (cervical cancer); K562A cell line (Leukemia); K562S cell line (Leukemia); LNCap/PC3 cell lines (Prostate cancer); Liver; Liver tumor (HCC); Non-small Cell Lung Carcinoma; OVCAR-3 cell line (Ovarian cancer); Ovarian tumor; Pancreatic islets; Platelet; Prostate tumor; Spermatozoa
Years 2007-2015

Glycosites

Site Identified Peptides Year(Publication ID)
537 QITAMAnR 2014(33);
537 GYQITAMAnR 2014(33);
537 ITAMAnRTIL 2014(33);
537 QITAMAnRTIL 2014(33);
537 YGYQITAMAnR 2014(33);
537 AnRTILVDNNTW 2014(33);
537 DYGYQITAMAnR 2014(33);
537 GYQITAMAnRTIL 2014(33);
537 MAnRTILVDNNTW 2014(33);
537 AMAnRTILVDNNTW 2014(33);
537 DYGYQITAMAnRTIL 2014(33);
537 QITAMAnRTILVDNNTW 2014(33);
537 VMSWWDYGYQITAMAnR 2009(64); 2012(48); 2013(43); 2014(16); 2014(19); 2014(33); 2015(unpublished);2015(1); 2015(2);
537 MAnRTILVDNNTWNNTHISR 2014(33);
544 nNTWNNTHISR 2014(33);
544 ANRTILVDnNTW 2014(33);
544 DnNTWNNTHISR 2014(33);
544 ILVDnNTWNNTH 2009(64);
544 MANRTILVDnNTW 2014(33);
544 TILVDnNTWNNTH 2014(33); 2015(unpublished);
544 VDnNTWNNTHISR 2013(37); 2014(33); 2015(unpublished);
544 AMANRTILVDnNTW 2014(33);
544 LVDnNTWNNTHISR 2014(33);
544 TILVDnNTWNNTHI 2012(48);
544 ILVDnNTWNNTHISR 2015(unpublished);
544 TIIVDnNTWNNTHISR 2013(43); 2014(16); 2014(32); 2014(32);
544 TILVDnNTWNNTHISR 2011(57); 2011(58); 2012(48); 2013(34); 2013(40); 2014(13); 2014(15); 2014(17); 2014(18); 2014(22); 2014(25); 2014(25); 2014(33); 2015(1); 2015(2); 2015(9); 2015(12); 2015(unpublished);2015(unpublished);2015(unpublished);2007(unpublished);2007;2007;2007;
544 QITAMANRTILVDnNTW 2014(33);
544 VDnNTWNNTHISRVGQA 2009(64);
544 MANRTILVDnNTWNNTHISR 2014(33);
548 nNTHISR 2015(1);
548 TWnNTHISR 2014(33); 2015(unpublished);
548 NTWnNTHISR 2014(33); 2015(unpublished);
548 NNTWnNTHISR 2014(33);
548 DNNTWnNTHISR 2014(33);
548 ILVDNNTWnNTH 2009(64);
548 TILVDNNTWnNTH 2014(33); 2015(unpublished);
548 VDNNTWnNTHISR 2013(37); 2014(33); 2015(unpublished);
548 LVDNNTWnNTHISR 2014(33);
548 TILVDNNTWnNTHI 2012(48);
548 ILVDNNTWnNTHISR 2015(unpublished);
548 TIIVDNNTWnNTHISR 2013(43); 2014(16); 2014(32); 2014(32);
548 TILVDNNTWnNTHISR 2011(57); 2011(58); 2012(48); 2013(34); 2013(40); 2014(13); 2014(15); 2014(17); 2014(18); 2014(22); 2014(25); 2014(25); 2014(33); 2015(1); 2015(2); 2015(9); 2015(12); 2015(unpublished);2015(unpublished);2015(unpublished);2007(unpublished);2007;2007;2007;
548 VDNNTWnNTHISRVGQA 2009(64);
548 MANRTILVDNNTWnNTHISR 2014(33);
548 nNTHISRVGQAMASTEEKAY 2014(33);

Sequence

1112131415161718191
MTKFGFLRLSYEKQDTLLKLLILSMAAVLSFSTRLFAVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDRAWYPLGRIIGGTIYPGLMITSAAIY
101111121131141151161171181191
HVLHFFHITIDIRNVCVFLAPLFSSFTTIVTYHLTKELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSICWAAKCAL
201211221231241251261271281291
AYFYMVSSWGGYVFLINLIPLHVLVLMLTGRFSHRIYVAYCTVYCLGTILSMQISFVGFQPVLSSEHMAAFGVFGLCQIHAFVDYLRSKLNPQQFEVLFR
301311321331341351361371381391
SVISLVGFVLLTVGALLMLTGKISPWTGRFYSLLDPSYAKNNIPIIASVSEHQPTTWSSYYFDLQLLVFMFPVGLYYCFSNLSDARIFIIMYGVTSMYFS
401411421431441451461471481491
AVMVRLMLVLAPVMCILSGIGVSQVLSTYMKNLDISRPDKKSKKQQDSTYPIKNEVASGMILVMAFFLITYTFHSTWVTSEAYSSPSIVLSARGGDGSRI
501511521531541551561571581591
IFDDFREAYYWLRHNTPEDAKVMSWWDYGYQITAMANRTILVDNNTWNNTHISRVGQAMASTEEKAYEIMRELDVSYVLVIFGGLTGYSSDDINKFLWMV
601611621631641651661671681691
RIGGSTDTGKHIKENDYYTPTGEFRVDREGSPVLLNCLMYKMCYYRFGQVYTEAKRPPGFDRVRNAEIGNKDFELDVLEEAYTTEHWLVRIYKVKDLDNR
701
GLSRT

Reference

ID Publication
1Sun S, Shah P, Eshghi ST, Yang W, Trikannad N, Yang S, Chen L, Aiyetan P, Hoti N, Zhang Z, et al: Comprehensive analysis of protein glycosylation by solid-phase extraction of N-linked glycans and glycosite-containing peptides. Nat Biotech 2015, advance online publication.
2Shah P, Wang X, Yang W, Eshghi ST, Sun S, Hoti N, Chen L, Yang S, Pasay J, Rubin A: Integrated Proteomic and Glycoproteomic Analyses of Prostate Cancer Cells Reveal Glycoprotein Alteration in Protein Abundance and Glycosylation. Molecular & Cellular Proteomics 2015, 14:2753-2763.
9Smeekens JM, Chen WX, Wu RH: Mass Spectrometric Analysis of the Cell Surface N-Glycoproteome by Combining Metabolic Labeling and Click Chemistry. Journal of the American Society for Mass Spectrometry 2015, 26:604-614.
12Weng Y, Sui Z, Jiang H, Shan Y, Chen L, Zhang S, Zhang L, Zhang Y: Releasing N-glycan from Peptide N-terminus by N-terminal Succinylation Assisted Enzymatic Deglycosylation. Scientific Reports 2015, 5.
13Yang W, Laeyendecker O, Wendel SK, Zhang B, Sun S, Zhou J-Y, Ao M, Moore RD, Jackson JB, Zhang H: Glycoproteomic Study Reveals Altered Plasma Proteins Associated with HIV Elite Suppressors. Theranostics 2014, 4:1153.
15Chen R, Seebun D, Ye M, Zou H, Figeys D: Site-specific characterization of cell membrane N-glycosylation with integrated hydrophilic interaction chromatography solid phase extraction and LC-MS/MS. Journal of Proteomics 2014, 103:194-203.
16Deeb SJ, Cox J, Schmidt-Supprian M, Mann M: N-linked Glycosylation Enrichment for In-depth Cell Surface Proteomics of Diffuse Large B-cell Lymphoma Subtypes. Molecular & Cellular Proteomics 2014, 13:240-251.
17Fang C, Xiong Z, Qin H, Huang G, Liu J, Ye M, Feng S, Zou H: One-pot synthesis of magnetic colloidal nanocrystal clusters coated with chitosan for selective enrichment of glycopeptides. Analytica Chimica Acta 2014, 841:99-105.
18Hirao Y, Matsuzaki H, Iwaki J, Kuno A, Kaji H, Ohkura T, Togayachi A, Abe M, Nomura M, Noguchi M, et al: Glycoproteomics Approach for Identifying Glycobiomarker Candidate Molecules for Tissue Type Classification of Non-small Cell Lung Carcinoma. Journal of Proteome Research 2014, 13:4705-4716.
19Huang G, Sun Z, Qin H, Zhao L, Xiong Z, Peng X, Ou J, Zou H: Preparation of hydrazine functionalized polymer brushes hybrid magnetic nanoparticles for highly specific enrichment of glycopeptides. Analyst 2014, 139:2199-2206.
22Nicastri A, Gaspari M, Sacco R, Elia L, Gabriele C, Romano R, Rizzuto A, Cuda G: N-Glycoprotein Analysis Discovers New Up-Regulated Glycoproteins in Colorectal Cancer Tissue. Journal of Proteome Research 2014, 13:4932-4941.
25Sun Z, Dong J, Zhang S, Hu Z, Cheng K, Li K, Xu B, Ye M, Nie Y, Fan D, Zou H: Identification of Chemoresistance-Related Cell-Surface Glycoproteins in Leukemia Cells and Functional Validation of Candidate Glycoproteins. Journal of Proteome Research 2014, 13:1593-1601.
32Zhang Z, Sun Z, Zhu J, Liu J, Huang G, Ye M, Zou H: High-Throughput Determination of the Site-Specific N-Sialoglycan Occupancy Rates by Differential Oxidation of Glycoproteins Followed with Quantitative Glycoproteomics Analysis. Analytical Chemistry 2014, 86:9830-9837.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
34Sun S, Zhang B, Aiyetan P, Zhou J-Y, Shah P, Yang W, Levine DA, Zhang Z, Chan DW, Zhang H: Analysis of N-glycoproteins using Genomic N-glycosite Prediction. Journal of Proteome Research 2013, 12:5609-5615.
37Boersema PJ, Geiger T, Wisniewski JR, Mann M: Quantification of the N-glycosylated Secretome by Super-SILAC During Breast Cancer Progression and in Human Blood Samples. Molecular & Cellular Proteomics 2013, 12:158-171.
40Li X, Jiang J, Zhao X, Wang J, Han H, Zhao Y, Peng B, Zhong R, Ying W, Qian X: N-glycoproteome Analysis of the Secretome of Human Metastatic Hepatocellular Carcinoma Cell Lines Combining Hydrazide Chemistry, HILIC Enrichment and Mass Spectrometry. Plos One 2013, 8.
43Wang GG, Wu YB, Zhou T, Guo YS, Zheng B, Wang J, Bi Y, Liu FJ, Zhou ZM, Guo XJ, Sha JH: Mapping of the N-Linked Glycoproteome of Human Spermatozoa. Journal of Proteome Research 2013, 12:5750-5759.
48Danzer C, Eckhardt K, Schmidt A, Fankhauser N, Ribrioux S, Wollscheid B, Mueller L, Schiess R, Zuellig R, Lehmann R, et al: Comprehensive Description of the N-Glycoproteome of Mouse Pancreatic beta-Cells and Human Islets. Journal of Proteome Research 2012, 11:1598-1608.
57Chen Y, Cao J, Yan G, Lu H, Yang P: Two-step protease digestion and glycopeptide capture approach for accurate glycosite identification and glycoprotein sequence coverage improvement. Talanta 2011, 85:70-75.
58Nagano K, Shinkawa T, Kato K, Inomata N, Yabuki N, Haramura M: Distinct cell surface proteome profiling by biotin labeling and glycoprotein capturing. Journal of Proteomics 2011, 74:1985-1993.
64Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res 2009, 8:651-661.