Contains      

UniProtKB-P49908

Protein Selenoprotein P
Gene SEPP1
Status Reviewed
Source Breast Cancer cell lines; Breast cancer xenografts; Breast tumor; Cerebrospinal fluid; Colorectal tumor; HCC cell lines (Liver); HepG2 cell line (Liver); HuH-7 cell line (Liver); Liver; Liver tumor (HCC); Lung Adenocarcinoma; Ovarian tumor; Plasma; Platelet; Prostate; Prostate tumor; Serum; Serum (HCC); Urine; lung; plasma
Years 2005-2015

Glycosites

Site Identified Peptides Year(Publication ID)
83 KKEGYSnISY 2014(33);
83 KKEGYSnISYIVV 2013(37);
83 GYSnISYIVVNHQGISSR 2014(33);
83 EGYSnISYIVVNHQGISSR 2005( 81); 2007(69); 2008(64); 2009(66); 2009(40); 2010(38); 2013(38); 2013(39); 2013(40); 2013(42); 2013(45); 2013(13); 2014(14); 2014(35); 2014(36); 2014(22); 2014(32); 2014(32); 2014(33); 2014(4); 2015(8); 2015(10); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015;2015;2015;2007;2007;2007;2007;2007;2007;
83 KEGYSnISYIVVNHQGISSR 2014(13); 2015(unpublished);2015(unpublished);2015(unpublished);
83 LKKEGYSnISYIVVNHQGISSR 2015(4);
119 HIPVYQQEEnQTD 2013(42); 2014(33);
119 VYQQEEnQTDVWT 2009(64);
119 HIPVYQQEEnQTDVW 2014(33);
119 HIPVYQQEEnQTDVWTLLNGSK 2014(33);
119 VSEHIPVYQQEEnQTDVWTIINGSK 2014(32); 2014(32);
119 VSEHIPVYQQEEnQTDVWTLLNGSK 2005( 81); 2007(40); 2010(38); 2013(42); 2013(45); 2013(13); 2014(35); 2014(24); 2014(33); 2014(4); 2015(8); 2015(10); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2007(unpublished);2007;2007;2007;2007;2007;
119 VSEHIPVYQQEEnQTDVWTLLNGSKDDFLIYDR 2012(53); 2013(45); 2014(13); 2014(35); 2014(33); 2015(unpublished);2015(4); 2015(8);
128 HIPVYQQEENQTDVWTLLnGSK 2014(33);
128 VSEHIPVYQQEENQTDVWTIInGSK 2014(32); 2014(32);
128 VSEHIPVYQQEENQTDVWTLLnGSK 2005( 81); 2007(40); 2010(38); 2013(42); 2013(45); 2013(13); 2014(35); 2014(24); 2014(33); 2014(4); 2015(8); 2015(10); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2007(unpublished);2007;2007;2007;2007;2007;
128 VSEHIPVYQQEENQTDVWTLLnGSKDDFLIYDR 2012(53); 2013(45); 2014(13); 2014(35); 2014(33); 2015(unpublished);2015(4); 2015(8);
174 CGnCSLTTLK 2012(53); 2013(38); 2013(38); 2013(45); 2014(22); 2014(33); 2015(10); 2015(unpublished);2015(unpublished);2007(unpublished);2007;2007;
174 KCGnCSLTTLK 2014(13); 2014(33); 2015(unpublished);2015(4);
174 CGnCSLTTLKDE 2014(33);
174 CEKKCGnCSITTI 2013(37);
174 CEKKCGnCSLTTL 2014(33);
174 KCGnCSLTTLKDE 2014(33);
174 KKCGnCSLTTLKDE 2013(42);
174 CGnCSLTTLKDEDFCK 2007(73); 2012(53); 2013(38); 2013(38); 2013(38); 2013(45); 2014(13); 2014(35); 2014(33); 2015(unpublished);2015(4); 2015(8);
174 CGnCSLTTLKDEDFCKR 2013(38); 2013(38); 2013(38); 2014(13); 2014(35); 2014(33); 2015(unpublished);2015(4); 2015(8);
174 KCGnCSLTTLKDEDFCK 2014(13); 2014(35); 2014(33); 2015(unpublished);2015(4); 2015(8);

Sequence

1112131415161718191
MWRSLGLALALCLLPSGGTESQDQSSLCKQPPAWSIRDQDPMLNSNGSVTVVALLQASUYLCILQASKLEDLRVKLKKEGYSNISYIVVNHQGISSRLKY
101111121131141151161171181191
THLKNKVSEHIPVYQQEENQTDVWTLLNGSKDDFLIYDRCGRLVYHLGLPFSFLTFPYVEEAIKIAYCEKKCGNCSLTTLKDEDFCKRVSLATVDKTVET
201211221231241251261271281291
PSPHYHHEHHHNHGHQHLGSSELSENQQPGAPNAPTHPAPPGLHHHHKHKGQHRQGHPENRDMPASEDLQDLQKKLCRKRCINQLLCKLPTDSELAPRSU
301311321331341351361371381
CCHCRHLIFEKTGSAITUQCKENLPSLCSUQGLRAEENITESCQURLPPAAUQISQQLIPTEASASURUKNQAKKUEUPSN

Reference

ID Publication
4Cheow ESH, Sim KH, de Kleijn D, Lee CN, Sorokin V, Sze SK: Simultaneous Enrichment of Plasma Soluble and Extracellular Vesicular Glycoproteins Using Prolonged Ultracentrifugation-Electrostatic Repulsion-hydrophilic Interaction Chromatography (PUC-ERLIC) Approach. Molecular & Cellular Proteomics 2015, 14:1657-1671.
8Ma C, Zhang Q, Qu JY, Zhao XY, Li X, Liu YP, Wang PG: A precise approach in large scale core-fucosylated glycoprotein identification with low- and high-normalized collision energy. Journal of Proteomics 2015, 114:61-70.
10Tan ZJ, Yin HD, Nie S, Lin ZX, Zhu JH, Ruffin MT, Anderson MA, Simone DM, Lubman DM: Large-Scale Identification of Core-Fucosylated Glycopeptide Sites in Pancreatic Cancer Serum Using Mass Spectrometry. Journal of Proteome Research 2015, 14:1968-1978.
13Yang W, Laeyendecker O, Wendel SK, Zhang B, Sun S, Zhou J-Y, Ao M, Moore RD, Jackson JB, Zhang H: Glycoproteomic Study Reveals Altered Plasma Proteins Associated with HIV Elite Suppressors. Theranostics 2014, 4:1153.
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
22Nicastri A, Gaspari M, Sacco R, Elia L, Gabriele C, Romano R, Rizzuto A, Cuda G: N-Glycoprotein Analysis Discovers New Up-Regulated Glycoproteins in Colorectal Cancer Tissue. Journal of Proteome Research 2014, 13:4932-4941.
24Song E, Zhu R, Hammond ZT, Mechref Y: LC-MS/MS Quantitation of Esophagus Disease Blood Serum Glycoproteins by Enrichment with Hydrazide Chemistry and Lectin Affinity Chromatography. Journal of Proteome Research 2014, 13:4808-4820.
32Zhang Z, Sun Z, Zhu J, Liu J, Huang G, Ye M, Zou H: High-Throughput Determination of the Site-Specific N-Sialoglycan Occupancy Rates by Differential Oxidation of Glycoproteins Followed with Quantitative Glycoproteomics Analysis. Analytical Chemistry 2014, 86:9830-9837.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
35Chen J, Shah P, Zhang H: Solid phase extraction of N-linked glycopeptides using hydrazide tip. Analytical chemistry 2013, 85:10670-10674.
36Li QK, Shah P, Li Y, Aiyetan PO, Chen J, Yung R, Molena D, Gabrielson E, Askin F, Chan DW: Glycoproteomic analysis of bronchoalveolar lavage (BAL) fluid identifies tumor-associated glycoproteins from lung adenocarcinoma. Journal of proteome research 2013, 12:3689-3696.
37Boersema PJ, Geiger T, Wisniewski JR, Mann M: Quantification of the N-glycosylated Secretome by Super-SILAC During Breast Cancer Progression and in Human Blood Samples. Molecular & Cellular Proteomics 2013, 12:158-171.
38Kaji H, Ocho M, Togayachi A, Kuno A, Sogabe M, Ohkura T, Nozaki H, Angata T, Chiba Y, Ozaki H, et al: Glycoproteomic Discovery of Serological Biomarker Candidates for HCV/HBV Infection-Associated Liver Fibrosis and Hepatocellular Carcinoma. Journal of Proteome Research 2013, 12:2630-2640.
39Li QK, Shah P, Li Y, Aiyetan PO, Chen J, Yung R, Molena D, Gabrielson E, Askin F, Chan DW, Zhang H: Glycoproteomic Analysis of Bronchoalveolar Lavage (BAL) Fluid Identifies Tumor-Associated Glycoproteins from Lung Adenocarcinonna. Journal of Proteome Research 2013, 12:3689-3696.
40Li X, Jiang J, Zhao X, Wang J, Han H, Zhao Y, Peng B, Zhong R, Ying W, Qian X: N-glycoproteome Analysis of the Secretome of Human Metastatic Hepatocellular Carcinoma Cell Lines Combining Hydrazide Chemistry, HILIC Enrichment and Mass Spectrometry. Plos One 2013, 8.
42Ma C, Zhao X, Han H, Tong W, Zhang Q, Qin P, Chang C, Peng B, Ying W, Qian X: N-linked glycoproteome profiling of human serum using tandem enrichment and multiple fraction concatenation. Electrophoresis 2013, 34:2440-2450.
45Zhou H, Froehlich JW, Briscoe AC, Lee RS: The GlycoFilter: A Simple and Comprehensive Sample Preparation Platform for Proteomics, N-Glycomics and Glycosylation Site Assignment. Molecular & Cellular Proteomics 2013, 12:2981-2991.
53Zhu J, Wang F, Chen R, Cheng K, Xu B, Guo Z, Liang X, Ye M, Zou H: Centrifugation Assisted Microreactor Enables Facile Integration of Trypsin Digestion, Hydrophilic Interaction Chromatography Enrichment, and On-Column Deglycosylation for Rapid and Sensitive N-Glycoproteome Analysis. Analytical Chemistry 2012, 84:5146-5153.
64Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res 2009, 8:651-661.
66Jia W, Lu Z, Fu Y, Wang H-P, Wang L-H, Chi H, Yuan Z-F, Zheng Z-B, Song L-N, Han H-H, et al: A Strategy for Precise and Large Scale Identification of Core Fucosylated Glycoproteins. Molecular & Cellular Proteomics 2009, 8:913-923.
69Calvano CD, Zambonin CG, Jensen ON: Assessment of lectin and HILIC based enrichment protocols for characterization of serum glycoproteins by mass spectrometry. Journal of Proteomics 2008, 71:304-317.
73Larsen MR, Jensen SS, Jakobsen LA, Heegaard NHH: Exploring the sialiome using titanium dioxide chromatography and mass spectrometry. Molecular & Cellular Proteomics 2007, 6:1778-1787.